KEGG   Homo sapiens (human): 23552Help
Entry
23552             CDS       T01001                                 

Gene name
CDK20, CCRK, CDCH, P42, PNQALRE
Definition
(RefSeq) cyclin dependent kinase 20
  KO
K08817  cell cycle related kinase [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23552 (CDK20)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     23552 (CDK20)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   23552 (CDK20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 23552
NCBI-ProteinID: NP_001034892
OMIM: 610076
HGNC: 21420
Ensembl: ENSG00000156345
Vega: OTTHUMG00000020161
Pharos: Q8IZL9(Tbio)
UniProt: Q8IZL9
Position
9q22.1
AA seq 346 aa AA seqDB search
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHA
NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQ
YDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKI
SFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSEL
PIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtactgcatcctgggccgcatcggggagggcgcccacggcatcgtcttcaag
gccaagcacgtggagactggcgagatagttgccctcaagaaggtggccctaaggcggttg
gaggacggcttccctaaccaggccctgcgggagattaaggctctgcaggagatggaggac
aatcagtatgtggtacaactgaaggctgtgttcccacacggtggaggctttgtgctggcc
tttgagttcatgctgtcggatctggccgaggtggtgcgccatgcccagaggccactagcc
caggcacaggtcaagagctacctgcagatgctgctcaagggtgtcgccttctgccatgcc
aacaacattgtacatcgggacctgaaacctgccaacctgctcatcagcgcctcaggccag
ctcaagatagcggactttggcctggctcgagtcttttccccagacggcagccgcctctac
acacaccaggtggccaccaggtggtaccgagcccccgagctcctgtatggtgcccgccag
tatgaccagggcgtcgatctgtggtctgtgggctgcatcatgggggagctgttgaatggg
tccccccttttcccgggcaagaacgatattgaacagctttgctatgtgcttcgcatcttg
ggcaccccaaaccctcaagtctggccggagctcactgagctgccggactacaacaagatc
tcctttaaggagcaggtgcccatgcccctggaggaggtgctgcctgacgtctctccccag
gcattggatctgctgggtcaattccttctctaccctcctcaccagcgcatcgcagcttcc
aaggctctcctccatcagtacttcttcacagctcccctgcctgcccatccatctgagctg
ccgattcctcagcgtctagggggacctgcccccaaggcccatccagggcccccccacatc
catgacttccacgtggaccggcctcttgaggagtcgctgttgaacccagagctgattcgg
cccttcatcctggaggggtga

DBGET integrated database retrieval system