KEGG   Homo sapiens (human): 23553Help
Entry
23553             CDS       T01001                                 

Gene name
HYAL4, CSHY
Definition
(RefSeq) hyaluronoglucosaminidase 4
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    23553 (HYAL4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     23553 (HYAL4)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   23553 (HYAL4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes
   23553 (HYAL4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  23553 (HYAL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_56 EGF
Motif
Other DBs
NCBI-GeneID: 23553
NCBI-ProteinID: NP_036401
OMIM: 604510
HGNC: 5323
Ensembl: ENSG00000106302
Vega: OTTHUMG00000157349
Pharos: Q2M3T9(Tbio)
UniProt: Q2M3T9
Position
7q31.32
AA seq 481 aa AA seqDB search
MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYSGSCPED
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQ
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattatctgaaggacagttaaagctttgtgttgttcaaccagtacatctcact
tcatggctccttatattttttattctaaagtctatctcttgtctaaaacctgctcgactt
ccaatttatcaaaggaaaccttttatagctgcttggaatgctccaacagatcagtgtttg
ataaaatataatttaagactaaatttgaaaatgtttcctgtgattggaagcccactggcc
aaggccagggggcaaaatgtcactatattttatgtcaacagattgggatactatccgtgg
tatacatcacaaggggtccccattaatggaggtctcccacagaacataagtttacaagta
catctggaaaaagctgaccaagatattaattattacatccctgctgaagatttcagtgga
cttgctgttatagattgggaatattggcgaccacagtgggcccggaactggaactcaaaa
gatgtttacagacagaagtcaagaaagcttatttccgatatgggaaagaatgtatcagct
accgatattgaatatttagccaaagtgacctttgaagaaagtgcaaaagctttcatgaag
gaaaccatcaaattgggaattaagagccgacccaaaggcctttggggttattatttatat
cctgattgccacaattataacgtttatgccccaaactactctgggtcatgcccagaagac
gaagtcttgaggaacaatgagctctcttggctctggaacagcagtgctgctttatatcct
tctatcggtgtctggaaatcccttggagacagtgaaaacattttgcgcttctccaaattt
cgggtgcatgaatccatgaggatctccaccatgacatctcatgattatgctctgcctgta
tttgtctacacaaggctagggtacagagatgaacctttatttttcctttctaagcaagat
ctagtcagcaccataggagaaagtgctgccttgggagctgcaggcattgttatttgggga
gacatgaatttaactgcatccaaggccaactgtacaaaggtgaagcagtttgtgagttct
gatttagggagctacatagccaatgtgaccagagctgctgaggtatgcagccttcacctc
tgcaggaacaatggcaggtgcataaggaagatgtggaacgcgcccagttaccttcacttg
aaccctgcaagttaccacatagaggcctctgaggacggggagtttactgtgaaaggaaaa
gcatctgatacagacctggcagtgatggcagatacattttcctgtcattgttatcaggga
tatgaaggagctgattgcagagaaataaagacggctgatggctgctctggggtttcccct
tctcctggttcactaatgacactttgtctactgcttttagcaagttatcgaagcattcag
ttgtga

DBGET integrated database retrieval system