KEGG   Homo sapiens (human): 23557Help
Entry
23557             CDS       T01001                                 

Gene name
SNAPIN, BLOC1S7, BLOS7, BORCS3, SNAPAP
Definition
(RefSeq) SNAP associated protein
  KO
K20002  SNARE-associated protein Snapin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23557 (SNAPIN)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    23557 (SNAPIN)
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    23557 (SNAPIN)
  Others
   BLOC-1 complex
    23557 (SNAPIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snapin_Pallidin Laminin_II DUF1664
Motif
Other DBs
NCBI-GeneID: 23557
NCBI-ProteinID: NP_036569
OMIM: 607007
HGNC: 17145
Ensembl: ENSG00000143553
Vega: OTTHUMG00000037086
Pharos: O95295(Tbio)
UniProt: O95295
Position
1q21.3
AA seq 136 aa AA seqDB search
MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDN
LATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARR
RAMLDSGIYPPGSPGK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggctggttccgccgctgtatcgggggcagggaccccggtggcggggcccaca
ggccgcgaccttttcgccgaagggctgctggagttcctgcgacccgctgtgcagcagctc
gactctcacgtacacgccgtcagagagagccaggtagagctccgggaacaaattgacaac
ctagccacagaactgtgccgcataaatgaggatcagaaggtggccctggatcttgacccc
tatgttaagaagctacttaatgcccggcgacgcgttgtcttggttaacaacattctacag
aatgctcaggaacgactgagacggctaaaccacagtgttgccaaggaaacagcccgcagg
agagcaatgctggattcgggaatttacccccctggctccccaggcaaataa

DBGET integrated database retrieval system