KEGG   Homo sapiens (human): 2356
Entry
2356              CDS       T01001                                 

Gene name
FPGS
Definition
(RefSeq) folylpolyglutamate synthase
  KO
K01930  folylpolyglutamate synthase [EC:6.3.2.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
hsa01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    2356 (FPGS)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2356 (FPGS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.17  tetrahydrofolate synthase
     2356 (FPGS)
SSDB
Motif
Pfam: Mur_ligase_C
Other DBs
NCBI-GeneID: 2356
NCBI-ProteinID: NP_004948
OMIM: 136510
HGNC: 3824
Ensembl: ENSG00000136877
Vega: OTTHUMG00000020716
Pharos: Q05932(Tchem)
UniProt: Q05932
Position
9q34.11
AA seq 587 aa
MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAG
YLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRS
YGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGE
HQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEW
PGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEE
QASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSP
PKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtcgcgggcgcggagccacctgcgcgccgctctattcctggcagcggcgtctgcgcgc
ggcataacgacccaggtcgcggcgcggcggggcttgagcgcgtggccggtgccgcaggag
ccgagcatggagtaccaggatgccgtgcgcatgctcaataccctgcagaccaatgccggc
tacctggagcaggtgaagcgccagcggggtgaccctcagacacagttggaagccatggaa
ctgtacctggcacggagtgggctgcaggtggaggacttggaccggctgaacatcatccac
gtcactgggacgaaggggaagggctccacctgtgccttcacggaatgtatcctccgaagc
tatggcctgaagacgggattctttagctctccccacctggtgcaggttcgggagcggatc
cgcatcaatgggcagcccatcagtcctgagctcttcaccaagtacttctggcgcctctac
caccggctggaggagaccaaggatggcagctgtgtctccatgcccccctacttccgcttc
ctgacactcatggccttccacgtcttcctccaagagaaggtggacctggcagtggtggag
gtgggcattggcggggcttatgactgcaccaacatcatcaggaagcctgtggtgtgcgga
gtctcctctcttggcatcgaccacaccagcctcctgggggatacggtggagaagatcgca
tggcagaaagggggcatctttaagcaaggtgtccctgccttcactgtgctccaacctgaa
ggtcccctggcagtgctgagggaccgagcccagcagatctcatgtcctctatacctgtgt
ccgatgctggaggccctcgaggaaggggggccgccgctgaccctgggcctggagggggag
caccagcggtccaacgccgccttggccttgcagctggcccactgctggctgcagcggcag
gaccgccatggtgctggggagccaaaggcatccaggccagggctcctgtggcagctgccc
ctggcacctgtgttccagcccacatcccacatgcggctcgggcttcggaacacggagtgg
ccgggccggacgcaggtgctgcggcgcgggcccctcacctggtacctggacggtgcgcac
accgccagcagcgcgcaggcctgcgtgcgctggttccgccaggcgctgcagggccgcgag
aggccgagcggtggccccgaggttcgagtcttgctcttcaatgctaccggggaccgggac
ccggcggccctgctgaagctgctgcagccctgccagtttgactatgccgtcttctgccct
aacctgacagaggtgtcatccacaggcaacgcagaccaacagaacttcacagtgacactg
gaccaggtcctgctccgctgcctggaacaccagcagcactggaaccacctggacgaagag
caggccagcccggacctctggagtgcccccagcccagagcccggtgggtccgcatccctg
cttctggcgccccacccaccccacacctgcagtgccagctccctcgtcttcagctgcatt
tcacatgccttgcaatggatcagccaaggccgagaccccatcttccagccacctagtccc
ccaaagggcctcctcacccaccctgtggctcacagtggggccagcatactccgtgaggct
gctgccatccatgtgctagtcactggcagcctgcacctggtgggtggtgtcctgaagctg
ctggagcccgcactgtcccagtag

DBGET integrated database retrieval system