KEGG   Homo sapiens (human): 23562
Entry
23562             CDS       T01001                                 
Symbol
CLDN14, DFNB29
Name
(RefSeq) claudin 14
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    23562 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23562 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    23562 (CLDN14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    23562 (CLDN14)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23562 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    23562 (CLDN14)
   04147 Exosome [BR:hsa04147]
    23562 (CLDN14)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   23562 (CLDN14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   23562 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   23562 (CLDN14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Laminin_EGF
Other DBs
NCBI-GeneID: 23562
NCBI-ProteinID: NP_001139549
OMIM: 605608
HGNC: 2035
Ensembl: ENSG00000159261
Pharos: O95500(Tbio)
UniProt: O95500
Position
21:complement(36460621..36576569)
AA seq 239 aa
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL
GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccagcacggccgtgcagcttctgggcttcctgctcagcttcctgggcatggtgggc
acgttgatcaccaccatcctgccgcactggcggaggacagcgcacgtgggcaccaacatc
ctcacggccgtgtcctacctgaaagggctctggatggagtgtgtgtggcacagcacaggc
atctaccagtgccagatctaccgatccctgctggcgctgccccaagacctccaggctgcc
cgcgccctcatggtcatctcctgcctgctctcgggcatagcctgcgcctgcgccgtcatc
gggatgaagtgcacgcgctgcgccaagggcacacccgccaagaccacctttgccatcctc
ggcggcaccctcttcatcctggccggcctcctgtgcatggtggccgtctcctggaccacc
aacgacgtggtgcagaacttctacaacccgctgctgcccagcggcatgaagtttgagatt
ggccaggccctgtacctgggcttcatctcctcgtccctctcgctcattggtggcaccctg
ctttgcctgtcctgccaggacgaggcaccctacaggccctaccaggccccgcccagggcc
accacgaccactgcaaacaccgcacctgcctaccagccaccagctgcctacaaagacaat
cgggccccctcagtgacctcggccacgcacagcgggtacaggctgaacgactacgtgtga

DBGET integrated database retrieval system