KEGG   Homo sapiens (human): 23567
Entry
23567             CDS       T01001                                 

Gene name
ZNF346, JAZ, Zfp346
Definition
(RefSeq) zinc finger protein 346
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-U1 zf-C2H2_2 Vps39_2 TUTase
Other DBs
NCBI-GeneID: 23567
NCBI-ProteinID: NP_036411
OMIM: 605308
HGNC: 16403
Ensembl: ENSG00000113761
Vega: OTTHUMG00000130848
Pharos: Q9UL40(Tbio)
UniProt: Q9UL40
Structure
PDB: 
2MKN 2MKD

Position
5q35.2
AA seq 294 aa
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREM
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagtatcccgcgccggccacggtgcaggccgcggacggcggagcggccgggccttac
agcagctcggagttgctggagggccaggagccggacggggtgcgctttgaccgcgagagg
gcgcgccgcctgtgggaagccgtgtccggtgcccagccggtgggtagagaggaagtggag
cacatgatccagaagaaccaatgtctcttcaccaacacccagtgtaaggtttgctgcgcc
ttgcttatttctgagtcccagaagctggcacattaccagagcaaaaaacatgccaacaaa
gtgaagagatacctagcaatccatggaatggagacattaaagggggaaacgaagaagcta
gactcagatcagaagagcagcagaagcaaagacaagaaccagtgctgccccatctgtaac
atgaccttttcctcccctgtcgtggcccagtcgcactacctggggaagacccacgcaaag
aacttaaagctgaagcagcagtccactaaggtggaagccttgcaccagaatagagagatg
atagacccagacaagttctgcagcctctgccatgcaactttcaacgaccctgtcatggct
caacaacattatgtgggcaagaaacacagaaaacaggagaccaagctcaaactaatggca
cgctatgggcggctggcggaccctgctgtcactgactttccagctggaaagggctacccc
tgcaaaacatgtaagatagtgctgaactccatagaacagtaccaagctcatgtcagcggc
ttcaaacacaagaaccagtcaccaaaaacagtggcatcatccctgggccagattccaatg
caaaggcaacccattcagaaagactcaaccaccttggaagactag

DBGET integrated database retrieval system