KEGG   Homo sapiens (human): 23568Help
Entry
23568             CDS       T01001                                 

Gene name
ARL2BP, BART, BART1, RP66
Definition
(RefSeq) ADP ribosylation factor like GTPase 2 binding protein
  KO
K16742  ADP-ribosylation factor-like protein 2-binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23568 (ARL2BP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    23568 (ARL2BP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARL2_Bind_BART
Motif
Other DBs
NCBI-GeneID: 23568
NCBI-ProteinID: NP_036238
OMIM: 615407
HGNC: 17146
Ensembl: ENSG00000102931
Vega: OTTHUMG00000133459
Pharos: Q9Y2Y0(Tbio)
UniProt: Q9Y2Y0 A0A024R6U9
Structure
PDB: 

Position
16q13
AA seq 163 aa AA seqDB search
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKL
IYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLA
FKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttagaaggagagagctttgcgctgtctttctcctccgcctctgatgcagaa
tttgatgctgtggttggatatttagaggacattatcatggatgacgagttccagttatta
cagagaaatttcatggacaagtactacctggagtttgaagacacagaagagaataaactc
atctacacacctatttttaatgaatacatttctttggtagaaaaatacattgaagaacag
ctgctgcagcggattcctgagttcaacatggcagccttcaccacaacattacagcaccat
aaggatgaagtggctggtgacatattcgacatgctgctcaccttcacagattttctggct
tttaaagaaatgtttttggactacagagcagaaaaagaaggccgaggactggacttaagc
agtggcttagtggtgacttcattgtgcaaatcatcttctctgccagcttcccagaacaat
ctgcggcactag

DBGET integrated database retrieval system