KEGG   Homo sapiens (human): 23569Help
Entry
23569             CDS       T01001                                 

Gene name
PADI4, PAD, PAD4, PADI5, PDI4, PDI5
Definition
(RefSeq) peptidyl arginine deiminase 4
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     23569 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 23569
NCBI-ProteinID: NP_036519
OMIM: 605347
HGNC: 18368
Ensembl: ENSG00000159339
Vega: OTTHUMG00000002371
Pharos: Q9UM07(Tchem)
UniProt: Q9UM07
Structure
PDB: 

Position
1p36.13
AA seq 663 aa AA seqDB search
MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKK
KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCAD
ITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDM
SLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV
PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAP
HKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP
APDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNS
FVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKWWN
MVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacattgatccgtgtgaccccagagcagcccacccatgccgtgtgtgtg
ctgggcaccttgactcagcttgacatctgcagctctgcccctgaggactgcacgtccttc
agcatcaacgcctccccaggggtggtcgtggatattgcccacggccctccagccaagaag
aaatccacaggttcctccacatggcccctggaccctggggtagaggtgaccctgacgatg
aaagtggccagtggtagcacaggcgaccagaaggttcagatttcatactacggacccaag
actccaccagtcaaagctctactctacctcaccggggtggaaatctccttgtgcgcagac
atcacccgcaccggcaaagtgaagccaaccagagctgtgaaagatcagaggacctggacc
tggggcccttgtggacagggtgccatcctgctggtgaactgtgacagagacaatctcgaa
tcttctgccatggactgcgaggatgatgaagtgcttgacagcgaagacctgcaggacatg
tcgctgatgaccctgagcacgaagacccccaaggacttcttcacaaaccatacactggtg
ctccacgtggccaggtctgagatggacaaagtgagggtgtttcaggccacacggggcaaa
ctgtcctccaagtgcagcgtagtcttgggtcccaagtggccctctcactacctgatggtc
cccggtggaaagcacaacatggacttctacgtggaggccctcgctttcccggacaccgac
ttcccggggctcattaccctcaccatctccctgctggacacgtccaacctggagctcccc
gaggctgtggtgttccaagacagcgtggtcttccgcgtggcgccctggatcatgaccccc
aacacccagcccccgcaggaggtgtacgcgtgcagtatttttgaaaatgaggacttcctg
aagtcagtgactactctggccatgaaagccaagtgcaagctgaccatctgccctgaggag
gagaacatggatgaccagtggatgcaggatgaaatggagatcggctacatccaagcccca
cacaaaacgctgcccgtggtcttcgactctccaaggaacagaggcctgaaggagtttccc
atcaaacgcgtgatgggtccagattttggctatgtaactcgagggccccaaacagggggt
atcagtggactggactcctttgggaacctggaagtgagccccccagtcacagtcaggggc
aaggaatacccgctgggcaggattctcttcggggacagctgttatcccagcaatgacagc
cggcagatgcaccaggccctgcaggacttcctcagtgcccagcaggtgcaggcccctgtg
aagctctattctgactggctgtccgtgggccacgtggacgagttcctgagctttgtgcca
gcacccgacaggaagggcttccggctgctcctggccagccccaggtcctgctacaaactg
ttccaggagcagcagaatgagggccacggggaggccctgctgttcgaagggatcaagaaa
aaaaaacagcagaaaataaagaacattctgtcaaacaagacattgagagaacataattca
tttgtggagagatgcatcgactggaaccgcgagctgctgaagcgggagctgggcctggcc
gagagtgacatcattgacatcccgcagctcttcaagctcaaagagttctctaaggcggaa
gcttttttccccaacatggtgaacatgctggtgctagggaagcacctgggcatccccaag
cccttcgggcccgtcatcaacggccgctgctgcctggaggagaaggtgtgttccctgctg
gagccactgggcctccagtgcaccttcatcaacgacttcttcacctaccacatcaggcat
ggggaggtgcactgcggcaccaacgtgcgcagaaagcccttctccttcaagtggtggaac
atggtgccctga

DBGET integrated database retrieval system