KEGG   Homo sapiens (human): 2357Help
Entry
2357              CDS       T01001                                 

Gene name
FPR1, FMLP, FPR
Definition
(RefSeq) formyl peptide receptor 1
  KO
K04172  formyl peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2357 (FPR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2357 (FPR1)
 09160 Human Diseases
  09167 Infectious diseases
   05150 Staphylococcus aureus infection
    2357 (FPR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2357 (FPR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   fMet-Leu-Phe
    2357 (FPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Phage_holin_2_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 2357
NCBI-ProteinID: NP_001180235
OMIM: 136537
HGNC: 3826
Ensembl: ENSG00000171051
Vega: OTTHUMG00000183500
Pharos: P21462(Tchem)
UniProt: P21462
Position
19q13.41
AA seq 350 aa AA seqDB search
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaattcctctctccccacgaacatctctggagggacacctgctgtatctgct
ggctatctcttcctggatatcatcacttatctggtatttgcagtcacctttgtcctcggg
gtcctgggcaacgggcttgtgatctgggtggctggattccggatgacacacacagtcacc
accatcagttacctgaacctggccgtggctgacttctgtttcacctccactttgccattc
ttcatggtcaggaaggccatgggaggacattggcctttcggctggttcctgtgcaaattc
gtctttaccatagtggacatcaacttgttcggaagtgtcttcctgatcgccctcattgct
ctggaccgctgtgtttgcgtcctgcatccagtctggacccagaaccaccgcaccgtgagc
ctggccaagaaggtgatcattgggccctgggtgatggctctgctcctcacattgccagtt
atcattcgtgtgactacagtacctggtaaaacggggacagtagcctgcacttttaacttt
tcgccctggaccaacgaccctaaagagaggataaatgtggccgttgccatgttgacggtg
agaggcatcatccggttcatcattggcttcagcgcacccatgtccatcgttgctgtcagt
tatgggcttattgccaccaagatccacaagcaaggcttgattaagtccagtcgtccctta
cgggtcctctcctttgtcgcagcagccttttttctctgctggtccccatatcaggtggtg
gcccttatagccacagtcagaatccgtgagttattgcaaggcatgtacaaagaaattggt
attgcagtggatgtgacaagtgccctggccttcttcaacagctgcctcaaccccatgctc
tatgtcttcatgggccaggacttccgggagaggctgatccacgcccttcccgccagtctg
gagagggccctgaccgaggactcaacccaaaccagtgacacagctaccaattctacttta
ccttctgcagaggtggagttacaggcaaagtga

DBGET integrated database retrieval system