KEGG   Homo sapiens (human): 2358Help
Entry
2358              CDS       T01001                                 

Gene name
FPR2, ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH1, FPRH2, FPRL1, HM63, LXA4R
Definition
(RefSeq) formyl peptide receptor 2
  KO
K04173  formyl peptide receptor-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2358 (FPR2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    2358 (FPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2358 (FPR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    2358 (FPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx RNA_pol_inhib
Motif
Other DBs
NCBI-GeneID: 2358
NCBI-ProteinID: NP_001005738
OMIM: 136538
HGNC: 3827
Ensembl: ENSG00000171049
Vega: OTTHUMG00000183501
Pharos: P25090(Tchem)
UniProt: P25090 A0A024R4P3
Position
19q13.41
AA seq 351 aa AA seqDB search
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaacttctccactcctctgaatgaatatgaagaagtgtcctatgagtctgct
ggctacactgttctgcggatcctcccattggtggtgcttggggtcacctttgtcctcggg
gtcctgggcaatgggcttgtgatctgggtggctggattccggatgacacgcacagtcacc
accatctgttacctgaacctggccctggctgacttttctttcacggccacattaccattc
ctcattgtctccatggccatgggagaaaaatggccttttggctggttcctgtgtaagtta
attcacatcgtggtggacatcaacctctttggaagtgtcttcttgattggtttcattgca
ctggaccgctgcatttgtgtcctgcatccagtctgggcccagaaccaccgcactgtgagt
ctggccatgaaggtgatcgtcggaccttggattcttgctctagtccttaccttgccagtt
ttcctctttttgactacagtaactattccaaatggggacacatactgtactttcaacttt
gcatcctggggtggcacccctgaggagaggctgaaggtggccattaccatgctgacagcc
agagggattatccggtttgtcattggctttagcttgccgatgtccattgttgccatctgc
tatgggctcattgcagccaagatccacaaaaagggcatgattaaatccagccgtccctta
cgggtcctcactgctgtggtggcttctttcttcatctgttggtttccctttcaactggtt
gcccttctgggcaccgtctggctcaaagagatgttgttctatggcaagtacaaaatcatt
gacatcctggttaacccaacgagctccctggccttcttcaacagctgcctcaaccccatg
ctttacgtctttgtgggccaagacttccgagagagactgatccactccctgcccaccagt
ctggagagggccctgtctgaggactcagccccaactaatgacacggctgccaattctgct
tcacctcctgcagagactgagttacaggcaatgtga

DBGET integrated database retrieval system