KEGG   Homo sapiens (human): 23581
Entry
23581             CDS       T01001                                 

Symbol
CASP14, ARCI12
Name
(RefSeq) caspase 14
  KO
K04401  caspase 14 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Disease
H00734  Autosomal recessive congenital ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23581 (CASP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     23581 (CASP14)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   23581 (CASP14)
SSDB
Motif
Pfam: Peptidase_C14 DUF2501
Other DBs
NCBI-GeneID: 23581
NCBI-ProteinID: NP_036246
OMIM: 605848
HGNC: 1502
Ensembl: ENSG00000105141
Vega: OTTHUMG00000183205
Pharos: P31944(Tbio)
UniProt: P31944 B2CIS9
Position
19:15049480..15058293
AA seq 242 aa
MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQ
FQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQAL
RAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRH
DQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
LQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagcaatccgcggtctttggaagaggagaaatatgatatgtcaggtgcccgcctggcc
ctaatactgtgtgtcaccaaagcccgggaaggttccgaagaagacctggatgctctggaa
cacatgtttcggcagctgagattcgaaagcaccatgaaaagagaccccactgccgagcaa
ttccaggaagagctggaaaaattccagcaggccatcgattcccgggaagatcccgtcagt
tgtgccttcgtggtactcatggctcacgggagggaaggcttcctcaagggagaagatggg
gagatggtcaagctggagaatctcttcgaggccctgaacaacaagaactgccaggccctg
cgagctaagcccaaggtgtacatcatacaggcctgtcgaggagaacaaagggaccccggt
gaaacagtaggtggagatgagattgtgatggtcatcaaagacagcccacaaaccatccca
acatacacagatgccttgcacgtttattccacggtagagggatacatcgcctaccgacat
gatcagaaaggctcatgctttatccagaccctggtggatgtgttcacgaagaggaaagga
catatcttggaacttctgacagaggtgacccggcggatggcagaagcagagctggttcaa
gaaggaaaagcaaggaaaacgaaccctgaaatccaaagcaccctccggaaacggctgtat
ctgcagtag

DBGET integrated database retrieval system