KEGG   Homo sapiens (human): 23584
Entry
23584             CDS       T01001                                 

Gene name
VSIG2, 2210413P10Rik, CTH, CTXL
Definition
(RefSeq) V-set and immunoglobulin domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 23584
NCBI-ProteinID: NP_055127
OMIM: 606011
HGNC: 17149
Ensembl: ENSG00000019102
Vega: OTTHUMG00000150357
Pharos: Q96IQ7(Tdark)
UniProt: Q96IQ7
Position
11q24.2
AA seq 327 aa
MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWS
FVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYL
CQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWV
RLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQG
RVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGGSDLREDAIAPGISEHTCMRA
DSSKGFLERPSSASTVTTTKSKLPMVV
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccgagctcccggggccctttctctgcggggccctgctaggcttcctgtgcctgagt
gggctggccgtggaggtgaaggtacccacagagccgctgagcacgcccctggggaagaca
gccgagctgacctgcacctacagcacgtcggtgggagacagcttcgccctggagtggagc
tttgtgcagcctgggaaacccatctctgagtcccatccaatcctgtacttcaccaatggc
catctgtatccaactggttctaagtcaaagcgggtcagcctgcttcagaacccccccaca
gtgggggtggccacactgaaactgactgacgtccacccctcagatactggaacctacctc
tgccaagtcaacaacccaccagatttctacaccaatgggttggggctaatcaaccttact
gtgctggttccccccagtaatcccttatgcagtcagagtggacaaacctctgtgggaggc
tctactgcactgagatgcagctcttccgagggggctcctaagccagtgtacaactgggtg
cgtcttggaacttttcctacaccttctcctggcagcatggttcaagatgaggtgtctggc
cagctcattctcaccaacctctccctgacctcctcgggcacctaccgctgtgtggccacc
aaccagatgggcagtgcatcctgtgagctgaccctctctgtgaccgaaccctcccaaggc
cgagtggccggagctctgattggggtgctcctgggcgtgctgttgctgtcagttgctgcg
ttctgcctggtcaggttccagaaagagagggggaagaagcccaaggagacatatgggggt
agtgaccttcgggaggatgccatcgctcctgggatctctgagcacacttgtatgagggct
gattctagcaaggggttcctggaaagaccctcgtctgccagcaccgtgacgaccaccaag
tccaagctccctatggtcgtgtga

DBGET integrated database retrieval system