KEGG   Homo sapiens (human): 23585Help
Entry
23585             CDS       T01001                                 

Gene name
TMEM50A, IFNRC, SMP1
Definition
(RefSeq) transmembrane protein 50A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0220
Motif
Other DBs
NCBI-GeneID: 23585
NCBI-ProteinID: NP_055128
OMIM: 605348
HGNC: 30590
Ensembl: ENSG00000183726
Vega: OTTHUMG00000007651
Pharos: O95807(Tdark)
UniProt: O95807 Q7RU07
Position
1p36.11
AA seq 157 aa AA seqDB search
MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACG
VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYV
AKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtctggatttctagagggcttgagatgctcagaatgcattgactggggggaaaagcgc
aatactattgcttccattgctgctggtgtactattttttacaggctggtggattatcata
gatgcagctgttatttatcccaccatgaaagatttcaaccactcataccatgcctgtggt
gttatagcaaccatagccttcctaatgattaatgcagtatcgaatggacaagtccgaggt
gatagttacagtgaaggttgtctgggtcaaacaggtgctcgcatttggcttttcgttggt
ttcatgttggcctttggatctctgattgcatctatgtggattctttttggaggttatgtt
gctaaagaaaaagacatagtataccctggaattgctgtatttttccagaatgccttcatc
ttttttggagggctggtttttaagtttggccgcactgaagacttatggcagtga

DBGET integrated database retrieval system