KEGG   Homo sapiens (human): 23587Help
Entry
23587             CDS       T01001                                 

Gene name
ELP5, C17orf81, DERP6, HSPC002, MST071, MSTP071
Definition
(RefSeq) elongator acetyltransferase complex subunit 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Elong_Iki1
Motif
Other DBs
NCBI-GeneID: 23587
NCBI-ProteinID: NP_056177
OMIM: 615019
HGNC: 30617
Ensembl: ENSG00000170291
Vega: OTTHUMG00000177974
Pharos: Q8TE02(Tdark)
UniProt: Q8TE02
Position
17p13.1
AA seq 316 aa AA seqDB search
MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILG
CEVSEEEFREGFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVT
IALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGAL
SSLAQTEVTLGGTMGQASAHILCRRPRQRPTDQTQWFSILPDFSLDLQEGPSVESQPYSD
PHIPPVDPTTHLTFNLHLSKKEREARDSLILPFQFSSEKQQALLRPRPGQATSHIFYEPD
AYDDLDQEDPDDDLDI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgccatcagagggcgccagagcagggaccggacgcgagttggagatgttggactcg
ctgttggccttgggcggcctggtgctgcttcgggattccgtggagtgggaggggcgcagt
ctcttgaaggcgcttgtcaagaaatctgcactgtgtggggagcaagtgcatatcctgggc
tgtgaagtgagcgaggaagagtttcgtgaaggttttgactctgatatcaacaatcggctg
gtttaccatgacttcttcagagaccctctcaactggtcaaaaactgaggaggcctttcct
ggggggccgctgggagccttgagagccatgtgcaagaggacagatcctgttcctgtcacc
attgctctcgattcactcagctggctgctacttcgccttccctgcaccacactctgccag
gtcctgcatgctgtgagccatcaggactcttgtcctggtgacagctcctcagtggggaaa
gtgagtgtgctgggcttgctacatgaagagcttcatggaccaggccctgtgggagctctc
agcagccttgctcagactgaggtgaccctgggcggtaccatgggccaggcctcggcccac
atcctgtgtcggaggccccgacagcgcccaactgaccagactcagtggttctccatcctt
ccggacttcagcctggatctccaagaggggccctctgtagagtcccagccctactccgat
cctcatatacccccggtggatcccacaactcatttgacctttaaccttcacctgtccaag
aaagagagagaagccagagatagcctgatcctgcccttccagttcagttctgaaaaacag
caggctctcctgcggcctaggccagggcaggctaccagccacatcttctatgagccagat
gcttatgatgacctggaccaagaagacccagatgacgacctggatatttga

DBGET integrated database retrieval system