KEGG   Homo sapiens (human): 2359Help
Entry
2359              CDS       T01001                                 

Gene name
FPR3, FML2_HUMAN, FMLP-R-II, FMLPY, FPRH1, FPRH2, FPRL2, RMLP-R-I
Definition
(RefSeq) formyl peptide receptor 3
  KO
K04173  formyl peptide receptor-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2359 (FPR3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2359 (FPR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2359 (FPR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    2359 (FPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 2359
NCBI-ProteinID: NP_002021
OMIM: 136539
HGNC: 3828
Ensembl: ENSG00000187474
Vega: OTTHUMG00000183502
Pharos: P25089(Tbio)
UniProt: P25089 Q6L5J4
Position
19q13.41
AA seq 353 aa AA seqDB search
METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN
TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA
LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF
AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL
RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaacttctccattcctctgaatgaaactgaggaggtgctccctgagcctgct
ggccacaccgttctgtggatcttctcattgctagtccacggagtcacctttgtcttcggg
gtcctgggcaatgggcttgtgatctgggtggctggattccggatgacacgcacagtcaac
accatctgttacctgaacctggccctagctgacttctctttcagtgccatcctaccattc
cgaatggtctcagtcgccatgagagaaaaatggccttttggctcattcctatgtaagtta
gttcatgttatgatagacatcaacctgtttgtcagtgtctacctgatcaccatcattgct
ctggaccgctgtatttgtgtcctgcatccagcctgggcccagaaccatcgcaccatgagt
ctggccaagagggtgatgacgggactctggattttcaccatagtccttaccttaccaaat
ttcatcttctggactacaataagtactacgaatggggacacatactgtattttcaacttt
gcattctggggtgacactgctgtagagaggttgaacgtgttcattaccatggccaaggtc
tttctgatcctccacttcattattggcttcagcgtgcctatgtccatcatcacagtctgc
tatgggatcatcgctgccaaaattcacagaaaccacatgattaaatccagccgtccctta
cgtgtcttcgctgctgtggtggcttctttcttcatctgttggttcccttatgaactaatt
ggcattctaatggcagtctggctcaaagagatgttgttaaatggcaaatacaaaatcatt
cttgtcctgattaacccaacaagctccttggccttttttaacagctgcctcaacccaatt
ctctacgtctttatgggtcgtaacttccaagaaagactgattcgctctttgcccactagt
ttggagagggccctgactgaggtccctgactcagcccagaccagcaacacagacaccact
tctgcttcacctcctgaggagacggagttacaagcaatgtga

DBGET integrated database retrieval system