KEGG   Homo sapiens (human): 23593Help
Entry
23593             CDS       T01001                                 

Gene name
HEBP2, C6ORF34B, C6orf34, PP23, SOUL
Definition
(RefSeq) heme binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SOUL PE-PPE
Motif
Other DBs
NCBI-GeneID: 23593
NCBI-ProteinID: NP_055135
OMIM: 605825
HGNC: 15716
Ensembl: ENSG00000051620
Vega: OTTHUMG00000015671
Pharos: Q9Y5Z4(Tbio)
UniProt: Q9Y5Z4
Structure
PDB: 

Position
6q24.1
AA seq 205 aa AA seqDB search
MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDS
AIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPP
RPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYN
SPVKLLNRNNEVWLIQKNEPTKENE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgctccagccagaccccggggcggccgaggacgcggcggcccaagctgtg
gagacgccgggctggaaggccccggaggacgccggcccccagcccggaagttatgagatc
cgacactatggaccagccaagtgggtcagcacgtccgtggagtctatggactgggattca
gccatccagacgggctttacgaaactgaacagctacattcaaggcaaaaacgagaaagag
atgaaaataaagatgacagctccagtgacaagctacgtggagcctggttcaggtcctttt
agtgagtctaccattaccatttccctgtatattccctctgaacagcaatttgatccaccc
aggcctttagagtcagatgtcttcattgaagatagagccgaaatgactgtgtttgtacgg
tctttcgatggattttctagtgcccaaaagaatcaagaacaacttttgacattagcaagc
attttaagggaagatggaaaagttttcgatgagaaggtttactacactgcaggctacaac
agtcctgtcaaattgcttaatagaaataatgaagtgtggttgattcaaaaaaatgaaccc
accaaagaaaacgaatga

DBGET integrated database retrieval system