KEGG   Homo sapiens (human): 23594Help
Entry
23594             CDS       T01001                                 

Gene name
ORC6, ORC6L
Definition
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23594 (ORC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    23594 (ORC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    23594 (ORC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC6
Motif
Other DBs
NCBI-GeneID: 23594
NCBI-ProteinID: NP_055136
OMIM: 607213
HGNC: 17151
Ensembl: ENSG00000091651
Vega: OTTHUMG00000132539
Pharos: Q9Y5N6(Tbio)
UniProt: Q9Y5N6 A0A024R6R3
Structure
PDB: 

Position
16q11.2
AA seq 252 aa AA seqDB search
MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMK
CPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKS
YESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLE
KIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKIL
ENAASAQKATAE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggagctgatcgggcgcctagccccgcgcctgggcctcgccgagcccgacatg
ctgaggaaagcagaggagtacttgcgcctgtcccgggtgaagtgtgtcggcctctccgca
cgcaccacggagaccagcagtgcagtcatgtgcctggaccttgcagcttcctggatgaag
tgccccttggacagggcttatttaattaaactttctggtttgaacaaggagacatatcag
agctgtcttaaatcttttgagtgtttactgggcctgaattcaaatattggaataagagac
ctagctgtacagtttagctgtatagaagcagtgaacatggcttcaaagatactaaaaagc
tatgagtccagtcttccccagacacagcaagtggatcttgacttatccaggccacttttc
acttctgctgcactgctttcagcatgcaagattctaaagctgaaagtggataaaaacaaa
atggtagccacatccggtgtaaaaaaagctatatttgatcgactgtgtaaacaactagag
aagattggacagcaggtcgacagagaacctggagatgtagctactccaccacggaagaga
aagaagatagtggttgaagccccagcaaaggaaatggagaaggtagaggagatgccacat
aaaccacagaaagatgaagatctgacacaggattatgaagaatggaaaagaaaaattttg
gaaaatgctgccagtgctcaaaaggctacagcagagtga

KEGG   Homo sapiens (human): 23595Help
Entry
23595             CDS       T01001                                 

Gene name
ORC3, LAT, LATHEO, ORC3L
Definition
(RefSeq) origin recognition complex subunit 3
  KO
K02605  origin recognition complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23595 (ORC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    23595 (ORC3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23595 (ORC3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    23595 (ORC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     23595 (ORC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC3_N ORC_WH_C
Motif
Other DBs
NCBI-GeneID: 23595
NCBI-ProteinID: NP_036513
OMIM: 604972
HGNC: 8489
Ensembl: ENSG00000135336
Vega: OTTHUMG00000015179
Pharos: Q9UBD5(Tbio)
UniProt: Q9UBD5
Structure
PDB: 

Position
6q15
AA seq 711 aa AA seqDB search
MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENER
LQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGS
LTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYS
MDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQH
LHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSN
NQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLH
KFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFK
SYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELR
RSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALH
TALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAE
KMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcctcgatgtctaagggttgctttgtttttaagccaaactccaaaaagaga
aagatctctctgccaatagaggactattttaacaaagggaaaaatgagcctgaggacagt
aagcttcgattcgaaacttatcagttgatatggcagcagatgaaatctgaaaatgagcga
ctacaagaggaattaaataaaaacttgtttgacaatctgattgaatttctgcaaaaatca
cattctggattccagaagaattcaagagacttgggcggtcaaataaaactcagagaaatt
ccaactgctgctcttgttcttggtgtgaatgtcacagatcatgatttgacattcggaagt
ctaacagaggcccttcagaataatgtcacaccatatgtagtctcattgcaagctaaagat
tgtccagatatgaaacattttttgcaaaagttgatctcacagttgatggactgctgtgta
gatataaaatccaaagaggaggaaagtgttcacgtcacccaaagaaagacacattattca
atggattcactttccagttggtatatgactgtcacacagaagacggacccaaaaatgcta
agcaaaaaaaggactacttctagccaatggcagtctcctcctgttgtcgttatcttgaag
gatatggaaagctttgccacaaaagtactacaagacttcataattatcagcagtcaacat
ctccatgaatttccactaatactcatttttggaatagccacatctcctattatcatccac
cgattgcttcctcatgcagtatcatctctattgtgcatagaactgttccaatctttgtct
tgtaaggagcacctgactacggtactcgataagctacttcttacaactcagtttcccttt
aaaataaatgaaaaagtattacaggttctgaccaacatctttttgtatcatgatttctca
gttcaaaactttataaaaggacttcagctttctctattagagcatttctattcccagccc
ttaagtgtcctgtgctgtaatcttccagaagccaaaagaagaataaattttttatcaaat
aatcaatgtgaaaacatccgacgtctaccatcttttaggaggtacgtggaaaagcaagct
tcagaaaagcaagttgcgctcttgaccaatgagagatatttgaaggaggaaacacaatta
ttactagaaaacctgcatgtttatcatatgaattacttcctggttttgagatgtcttcat
aagttcacctcttctcttcccaagtatccactaggtcgacagatcagagagttgtactgt
acatgtttagaaaagaacatatgggattcagaggagtatgcatcagtcttgcagctgctg
aggatgttggcaaaggatgaactgatgaccatacttgagaaatgtttcaaggtttttaag
tcttattgtgaaaaccaccttggcagcacagctaagagaatagaggagttcctggcccag
tttcagagcctcgatgaaaccaaagaggaagaagatgcttctgggtcacagccaaagggg
cttcagaagacagacctctatcatcttcagaagtccttattggaaatgaaggagttaaga
agaagtaagaagcaaaccaaatttgaagtactcagagaaaatgttgtgaacttcattgac
tgtctagtgagagaataccttctgcctcctgagacacagcctctccatgaggtggtgtac
ttcagtgctgcccatgcccttcgtgagcatttaaatgctgctccgcgaattgccctccat
actgcactcaacaatccttactattatctcaagaatgaagcactgaaaagcgaagaaggc
tgcattccgaatatcgccccagacatctgcatagcatacaaactgcacctagagtgtagc
aggctcatcaacctcgtggactggtcagaggcttttgcaacagttgtgacagctgctgaa
aaaatggatgcaaattctgcaacctcagaagaaatgaatgaaattatccatgctcggttt
attagagctgtttctgaactagaacttttaggatttataaaacctaccaaacagaagact
gaccatgtggcaagactaacatggggaggctgctag

KEGG   Homo sapiens (human): 4998Help
Entry
4998              CDS       T01001                                 

Gene name
ORC1, HSORC1, ORC1L, PARC1
Definition
(RefSeq) origin recognition complex subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4998 (ORC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4998 (ORC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4998 (ORC1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4998 (ORC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4998 (ORC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAH Cdc6_C AAA AAA_22 AAA_16 AAA_lid_10 AAA_19 AAA_30 DUF2075 NACHT SpoU_methylas_C NB-ARC
Motif
Other DBs
NCBI-GeneID: 4998
NCBI-ProteinID: NP_001177747
OMIM: 601902
HGNC: 8487
Ensembl: ENSG00000085840
Vega: OTTHUMG00000008104
Pharos: Q13415(Tbio)
UniProt: Q13415 Q96F82
Structure
PDB: 

Position
1p32.3
AA seq 861 aa AA seqDB search
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDD
ENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPAC
DSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQ
ESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG
NLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETG
LSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKK
RDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSS
SDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLA
AQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGK
TATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAEL
LAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPE
RIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDAR
RCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRA
ILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRND
LLLRVRLNVSQDDVLYALKDE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcacactaccccacaaggctgaagaccagaaaaacttattcatgggttggcaggccc
ttgttggatcgaaaactgcactaccaaacctatagagaaatgtgtgtgaaaacagaaggt
tgttccaccgagattcacatccagattggacagtttgtgttgattgaaggggatgatgat
gaaaacccgtatgttgctaaattgcttgagttgttcgaagatgactctgatcctcctcct
aagaaacgtgctcgagtacagtggtttgtccgattctgtgaagtccctgcctgtaaacgg
catttgttgggccggaagcctggtgcacaggaaatattctggtatgattacccggcctgt
gacagcaacattaatgcggagaccatcattggccttgttcgggtgatacctttagcccca
aaggatgtggtaccgacgaatctgaaaaatgagaagacactctttgtgaaactatcctgg
aatgagaagaaattcaggccactttcctcagaactatttgcggagttgaataaaccacaa
gagagtgcagccaagtgccagaaacccgtgagagccaagagtaagagtgcagagagccct
tcttggaccccagcagaacatgtggccaaaaggattgaatcaaggcactccgcctccaaa
tctcgccaaactcctacccatcctcttaccccaagagccagaaagaggctggagcttggc
aacttaggtaaccctcagatgtcccagcagacttcatgtgcctccttggattctccagga
agaataaaacggaaagtggccttctcggagatcacctcaccttctaagagatctcagcct
gataaacttcaaaccttgtctccagctctgaaagccccagagaaaaccagagagactgga
ctctcttatactgaggatgacaagaaggcttcacctgaacatcgcataatcctgagaacc
cgaattgcagcttcgaaaaccatagacattagagaggagagaacacttacccctatcagt
gggggacagagatcttcagtggtgccatccgtgattctgaaaccagaaaacatcaaaaag
agggatgcaaaagaagcaaaagcccagaatgaagcgacctctactccccatcgtatccgc
agaaagagttctgtcttgactatgaatcggattaggcagcagcttcggtttctaggtaat
agtaaaagtgaccaagaagagaaagagattctgccagcagcagagatttcagactctagc
agtgacgaagaagaggcttccacaccgccccttccaaggagagcacccagaactgtgtcc
aggaacctgcgatcttccttgaagtcatccttacataccctcacgaaggtgccaaagaag
agtctcaagcctagaacgccacgttgtgccgctcctcagatccgtagtcgaagcctggct
gcccaggagccagccagtgtgctggaggaagcccgactgaggctgcatgtttctgctgta
cctgagtctcttccctgtcgggaacaggaattccaagacatctacaattttgtggaaagc
aaactccttgaccataccggagggtgcatgtacatctccggtgtccctgggacagggaag
actgccactgttcatgaagtgatacgctgcctgcagcaggcagcccaagccaatgatgtt
cctccctttcaatacattgaggtcaatggcatgaagctgacggagccccaccaagtctat
gtgcaaatcttgcagaagctaacaggccaaaaagcaacagccaaccatgcggcagaactg
ctggcaaagcaattctgcacccgagggtcacctcaggaaaccaccgtcctgcttgtggat
gagctcgaccttctgtggactcacaaacaagacataatgtacaatctctttgactggccc
actcataaggaggcccggcttgtggtcctggcaattgccaacacaatggacctgccagag
cgaatcatgatgaaccgggtgtccagccgactgggtcttaccaggatgtgcttccagccc
tatacatatagccagctgcagcagatcctaaggtcccggctcaagcatctaaaggccttt
gaagatgatgccatccagctggtagccaggaaggtagcagcactgtctggagatgcacga
cggtgcctggacatctgcaggcgtgccacagagatctgtgagttctcccagcagaagcct
gactcccctggcctggtcaccatagcccactcaatggaagctgtggatgagatgttttca
tcatcatacatcacggccatcaaaaattcctctgttctggaacagagcttcctgagagcc
atcctcgcagagttccgtcgatcaggactggaggaagccacgtttcaacagatatatagt
caacatgtggcactgtgcagaatggagggactgccgtaccccaccatgtcagagaccatg
gccgtgtgttctcacctgggctcctgtcgcctcctgcttgtggagcccagcaggaacgat
ctgctccttcgggtgcggctcaacgtcagccaggatgatgtgctgtatgcgctgaaagac
gagtaa

KEGG   Homo sapiens (human): 4999Help
Entry
4999              CDS       T01001                                 

Gene name
ORC2, ORC2L
Definition
(RefSeq) origin recognition complex subunit 2
  KO
K02604  origin recognition complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4999 (ORC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4999 (ORC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4999 (ORC2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4999 (ORC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4999 (ORC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC2 PBECR3
Motif
Other DBs
NCBI-GeneID: 4999
NCBI-ProteinID: NP_006181
OMIM: 601182
HGNC: 8488
Ensembl: ENSG00000115942
Vega: OTTHUMG00000132783
Pharos: Q13416(Tbio)
UniProt: Q13416 A0A024R411
Structure
PDB: 

Position
2q33.1
AA seq 577 aa AA seqDB search
MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED
DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKS
VSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSE
SEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLV
EEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK
WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVL
DHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHV
LRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFR
DHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccagaattaaaggaagacaagatgctggaggttcactttgtgggagatgat
gatgttcttaatcacattctagatagagaaggaggagctaaattgaagaaggagcgagcg
cagcttttggtcaaccccaaaaaaataataaagaagccagaatatgatttggaggaagat
gaccaggaggtcttaaaagatcagaactatgtggaaattatgggaagagatgttcaagaa
tcattgaaaaatggctctgctacaggtggtggaaataaagtttattcttttcagaataga
aaacactctgaaaagatggctaaattagcttcagaactagcaaaaacaccacaaaaaagt
gtttcattcagtttgaagaatgatcctgagattacgataaacgttcctcaaagtagcaag
ggccattctgcttcagacaaggttcaaccgaagaacaatgacaaaagtgaatttctgtca
acagcacctcgtagtctaagaaaaagattaatagttccaaggtctcattctgacagtgaa
agcgaatattctgcttccaactcagaggatgatgaaggggttgcacaggaacatgaagag
gacactaatgcagtcatattcagccaaaagattcaagctcagaatagagtagtttcagct
cctgttggcaaagaaacaccttctaagagaatgaaaagagataaaacaagtgacttagta
gaagaatattttgaagctcacagcagttcaaaagttttaacctctgatagaacactgcag
aagctaaagagagctaaactggatcagcaaactttgcgtaacttattgagcaaggtttcc
ccttccttttctgccgaacttaaacaactaaatcaacagtatgaaaaattatttcataaa
tggatgctgcaattacaccttgggttcaacattgtgctttatggtttgggttctaagaga
gatttactagaaaggtttcgaaccactatgctgcaagattccattcacgttgtcatcaat
ggcttctttcctggaatcagtgtgaaatcagtcctgaattctataacagaagaagtcctc
gatcatatgggtactttccgcagtatactggatcagctagactggatagtaaacaaattt
aaagaagattcttctttagaactcttccttctcatccacaatttggatagccagatgttg
agaggagagaagagccagcaaatcattggtcagttgtcatctttgcataacatttacctt
atagcatccattgaccacctcaatgctcctctcatgtgggatcatgcaaagcagagtctt
tttaactggctctggtatgaaactactacatacagtccttatactgaagaaacctcctat
gagaactctcttctggtaaagcagtctggatccctgccacttagctcccttactcatgtc
ttacgaagccttacccctaatgcaaggggaattttcaggctactaataaaataccagctg
gacaaccaggataacccttcttacattggcctttcttttcaagatttttaccagcagtgt
cgggaggcattcctcgtcaatagtgatctgacactccgggcccagttaactgaatttagg
gaccacaagcttataagaacaaagaagggaactgatggagtagagtatttattaattcct
gttgataatggaacattgactgatttcttggaaaaggaagaagaggaggcttga

KEGG   Homo sapiens (human): 5000Help
Entry
5000              CDS       T01001                                 

Gene name
ORC4, ORC4L, ORC4P
Definition
(RefSeq) origin recognition complex subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5000 (ORC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5000 (ORC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    5000 (ORC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC4_C AAA_16 AAA AAA_22 ATPase_2 NACHT AAA_19 TniB AAA_14 DUF815 DUF2075 DAP3 T2SSE AAA_7 NB-ARC KAP_NTPase Mg_chelatase AAA_18 AAA_33 ABC_tran AAA_5 RsgA_GTPase cobW SRPRB AAA_29 AAA_30 AAA_24
Motif
Other DBs
NCBI-GeneID: 5000
NCBI-ProteinID: NP_001177808
OMIM: 603056
HGNC: 8490
Ensembl: ENSG00000115947
Vega: OTTHUMG00000131849
Pharos: O43929(Tbio)
UniProt: O43929
Structure
PDB: 

Position
2q23.1
AA seq 436 aa AA seqDB search
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgtaaatcaaagagtaacagcttaattcacacagagtgcctttcacaggta
caaagaattttacgtgaaagattttgtcgtcagagtccacatagtaacctatttggagtg
caagtacaatacaaacacttaagtgagctgctgaaaagaactgctctccatggagagagt
aactctgtccttattatcggaccccgaggatcaggaaaaactatgttaataaatcatgct
ttgaaagaactcatggaaatagaagaagtgagtgaaaatgtattacaagttcacttaaat
ggactgctgcagatcaatgacaaaatcgccctaaaggaaatcacaaggcagttaaatctg
gaaaatgtagttggagataaagtttttggaagctttgctgaaaacctttcatttcttctg
gaagctttaaaaaaaggtgaccgaactagcagttgcccagtgatcttcatattagatgaa
tttgatctttttgctcatcataaaaaccaaacacttctctataatctttttgacatttct
cagtctgcacagaccccaatagcagttattggtcttacatgtagattggatattttggaa
ctcttagaaaaaagagtgaagtcaagattttctcaccggcagatacacttaatgaattca
tttggttttccacagtatgttaaaatatttaaagaacagttatctctacctgcagagttt
ccagacaaggtttttgctgagaagtggaatgaaaatgttcagtatctctcagaagataga
agtgtgcaagaagtactacagaagcatttcaatatcagcaaaaacctgcggtcattacac
atgctattgatgcttgctttaaatcgagtaacagcatcgcacccatttatgactgccgta
gatctaatggaagcaagccaactgtgtagcatggactcgaaagcaaatattgtacatggt
ctatcagtcttggaaatctgtcttataatagcaatgaaacatttaaatgacatctatgag
gaagagccatttaattttcaaatggtctataatgagtttcagaagtttgttcaaaggaaa
gcacattccgtttataattttgaaaaacctgttgtcatgaaggcttttgaacacttgcag
caattagaattaataaagcccatggaaagaacttcaggaaattcacagagagagtaccag
ctgatgaaactgcttttggataatactcaaattatgaatgctctgcagaaatatcccaac
tgtcctacagatgtgaggcagtgggcaacatcctcactaagctggttatga

KEGG   Homo sapiens (human): 5001Help
Entry
5001              CDS       T01001                                 

Gene name
ORC5, ORC5L, ORC5P, ORC5T, PPP1R117
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5001 (ORC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5001 (ORC5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5001 (ORC5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5001 (ORC5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    5001 (ORC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC5_C AAA_16 AAA_22 Kinesin PIF1 AAA_24
Motif
Other DBs
NCBI-GeneID: 5001
NCBI-ProteinID: NP_002544
OMIM: 602331
HGNC: 8491
Ensembl: ENSG00000164815
Vega: OTTHUMG00000157275
Pharos: O43913(Tbio)
UniProt: O43913 A4D0P7 Q53FC8
Structure
PDB: 

Position
7q22.1-q22.2
AA seq 435 aa AA seqDB search
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccccacttggaaaacgtggtgctttgtcgcgagtctcaagtgtccatcttgcagtcc
ttgtttggagagagacatcatttcagctttccatccatttttatttatggacatactgct
agtggaaagacctatgtaacacaaacgttgttgaaaactttagagctcccacatgtgttt
gtgaattgtgttgaatgctttacattgaggctgcttttggaacaaattttaaacaaattg
aatcatcttagttcttcagaggatggatgttctactgaaataacctgtgaaacatttaat
gactttgttcgcttgtttaaacaagtaaccacagctgaaaatcttaaagatcagactgta
tatattgttctagataaagcagagtatctaagagatatggaagcaaatcttttgcctgga
tttcttagattacaagaattggctgacagaaatgtgactgttctctttctcagtgaaatt
gtttgggaaaagtttcgtccaaatactggatgctttgagccgtttgtcttatatttccct
gattacagcataggcaaccttcaaaagatcctgtcccatgatcatcctccagagtattca
gctgatttctatgctgcctacattaacattcttcttggagttttctacactgtttgtcga
gatttgaaagagctcagacatctggcagtacttaattttcctaaatattgtgaacccgtg
gttaaaggagaagcaagtgaacgtgatactcgcaaactgtggagaaatattgaacctcat
ttgaagaaagctatgcagactgtttatctcagggaaatatcaagttcccagtgggaaaag
ctacagaaagatgacacagatccggggcaactgaaaggcctctcagcgcatactcatgtg
gaacttccatattactctaagttcattctaattgctgcataccttgcttcatacaatcca
gcaagaactgacaagaggttttttcttaagcatcatggaaaaatcaagaaaaccaacttt
ctaaaaaaacacgaaaagacaagcaatcatctccttgggccaaaaccatttccactagac
agattattagcaatattatatagtatcgtggacagcagagttgctccaacagcaaatatt
ttttcccagattacctctctagtgacccttcagctgttaaccctggttggccatgacgat
cagcttgatggaccaaaatacaaatgcacagtgtctctagacttcatcagagctattgca
aggacggtgaactttgacataataaaatacttgtatgatttcttgtga

DBGET integrated database retrieval system