KEGG   Homo sapiens (human): 23595Help
Entry
23595             CDS       T01001                                 

Gene name
ORC3, LAT, LATHEO, ORC3L
Definition
(RefSeq) origin recognition complex subunit 3
  KO
K02605  origin recognition complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Module
hsa_M00284  Origin recognition complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    23595 (ORC3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    23595 (ORC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     23595 (ORC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC3_N
Motif
Other DBs
NCBI-GeneID: 23595
NCBI-ProteinID: NP_036513
OMIM: 604972
HGNC: 8489
Ensembl: ENSG00000135336
Vega: OTTHUMG00000015179
Pharos: Q9UBD5(Tbio)
UniProt: Q9UBD5
Structure
PDB: 

Position
6q15
AA seq 711 aa AA seqDB search
MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENER
LQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGS
LTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYS
MDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQH
LHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSN
NQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLH
KFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFK
SYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELR
RSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALH
TALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAE
KMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcctcgatgtctaagggttgctttgtttttaagccaaactccaaaaagaga
aagatctctctgccaatagaggactattttaacaaagggaaaaatgagcctgaggacagt
aagcttcgattcgaaacttatcagttgatatggcagcagatgaaatctgaaaatgagcga
ctacaagaggaattaaataaaaacttgtttgacaatctgattgaatttctgcaaaaatca
cattctggattccagaagaattcaagagacttgggcggtcaaataaaactcagagaaatt
ccaactgctgctcttgttcttggtgtgaatgtcacagatcatgatttgacattcggaagt
ctaacagaggcccttcagaataatgtcacaccatatgtagtctcattgcaagctaaagat
tgtccagatatgaaacattttttgcaaaagttgatctcacagttgatggactgctgtgta
gatataaaatccaaagaggaggaaagtgttcacgtcacccaaagaaagacacattattca
atggattcactttccagttggtatatgactgtcacacagaagacggacccaaaaatgcta
agcaaaaaaaggactacttctagccaatggcagtctcctcctgttgtcgttatcttgaag
gatatggaaagctttgccacaaaagtactacaagacttcataattatcagcagtcaacat
ctccatgaatttccactaatactcatttttggaatagccacatctcctattatcatccac
cgattgcttcctcatgcagtatcatctctattgtgcatagaactgttccaatctttgtct
tgtaaggagcacctgactacggtactcgataagctacttcttacaactcagtttcccttt
aaaataaatgaaaaagtattacaggttctgaccaacatctttttgtatcatgatttctca
gttcaaaactttataaaaggacttcagctttctctattagagcatttctattcccagccc
ttaagtgtcctgtgctgtaatcttccagaagccaaaagaagaataaattttttatcaaat
aatcaatgtgaaaacatccgacgtctaccatcttttaggaggtacgtggaaaagcaagct
tcagaaaagcaagttgcgctcttgaccaatgagagatatttgaaggaggaaacacaatta
ttactagaaaacctgcatgtttatcatatgaattacttcctggttttgagatgtcttcat
aagttcacctcttctcttcccaagtatccactaggtcgacagatcagagagttgtactgt
acatgtttagaaaagaacatatgggattcagaggagtatgcatcagtcttgcagctgctg
aggatgttggcaaaggatgaactgatgaccatacttgagaaatgtttcaaggtttttaag
tcttattgtgaaaaccaccttggcagcacagctaagagaatagaggagttcctggcccag
tttcagagcctcgatgaaaccaaagaggaagaagatgcttctgggtcacagccaaagggg
cttcagaagacagacctctatcatcttcagaagtccttattggaaatgaaggagttaaga
agaagtaagaagcaaaccaaatttgaagtactcagagaaaatgttgtgaacttcattgac
tgtctagtgagagaataccttctgcctcctgagacacagcctctccatgaggtggtgtac
ttcagtgctgcccatgcccttcgtgagcatttaaatgctgctccgcgaattgccctccat
actgcactcaacaatccttactattatctcaagaatgaagcactgaaaagcgaagaaggc
tgcattccgaatatcgccccagacatctgcatagcatacaaactgcacctagagtgtagc
aggctcatcaacctcgtggactggtcagaggcttttgcaacagttgtgacagctgctgaa
aaaatggatgcaaattctgcaacctcagaagaaatgaatgaaattatccatgctcggttt
attagagctgtttctgaactagaacttttaggatttataaaacctaccaaacagaagact
gaccatgtggcaagactaacatggggaggctgctag

DBGET integrated database retrieval system