KEGG   Homo sapiens (human): 23596
Entry
23596             CDS       T01001                                 
Symbol
OPN3, ECPN, PPP1R116
Name
(RefSeq) opsin 3
  KO
K04256  c-opsin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23596 (OPN3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    23596 (OPN3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23596 (OPN3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    23596 (OPN3)
SSDB
Motif
Pfam: 7tm_1 IRK
Other DBs
NCBI-GeneID: 23596
NCBI-ProteinID: NP_055137
OMIM: 606695
HGNC: 14007
Ensembl: ENSG00000054277 ENSG00000203668
Pharos: Q9H1Y3(Tbio)
UniProt: Q9H1Y3
Position
1:complement(241593124..241640369)
AA seq 402 aa
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNL
LVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFS
GSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYI
LDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQT
IQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKS
NTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRP
KKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtactcggggaaccgcagcggcggccacggctactgggacggcggcggggccgcgggc
gctgaggggccggcgccggcggggacactgagccccgcgcccctcttcagccccggcacc
tacgagcgcctggcgctgctgctgggctccattgggctgctgggcgtcggcaacaacctg
ctggtgctcgtcctctactacaagttccagcggctccgcactcccactcacctcctcctg
gtcaacatcagcctcagcgacctgctggtgtccctcttcggggtcacctttaccttcgtg
tcctgcctgaggaacggctgggtgtgggacaccgtgggctgcgtgtgggacgggtttagc
ggcagcctcttcgggattgtttccattgccaccctaaccgtgctggcctatgaacgttac
attcgcgtggtccatgccagagtgatcaatttttcctgggcctggagggccattacctac
atctggctctactcactggcgtgggcaggagcacctctcctgggatggaacaggtacatc
ctggacgtacacggactaggctgcactgtggactggaaatccaaggatgccaacgattcc
tcctttgtgcttttcttatttcttggctgcctggtggtgcccctgggtgtcatagcccat
tgctatggccatattctatattccattcgaatgcttcgttgtgtggaagatcttcagaca
attcaagtgatcaagattttaaaatatgaaaagaaactggccaaaatgtgctttttaatg
atattcaccttcctggtctgttggatgccttatatcgtgatctgcttcttggtggttaat
ggtcatggtcacctggtcactccaacaatatctattgtttcgtacctctttgctaaatcg
aacactgtatacaatccagtgatttatgtcttcatgatcagaaagtttcgaagatccctt
ttgcagcttctgtgcctccgactgctgaggtgccagaggcctgctaaagacctaccagca
gctggaagtgaaatgcagatcagacccattgtgatgtcacagaaagatggggacaggcca
aagaaaaaagtgactttcaactcttcttccatcatttttatcatcaccagtgatgaatca
ctgtcagttgacgacagcgacaaaaccaatgggtccaaagttgatgtaatccaagttcgt
cctttgtag

DBGET integrated database retrieval system