KEGG   Homo sapiens (human): 23598
Entry
23598             CDS       T01001                                 

Gene name
PATZ1, MAZR, PATZ, RIAZ, ZBTB19, ZNF278, ZSG, dJ400N23
Definition
(RefSeq) POZ/BTB and AT hook containing zinc finger 1
  KO
K24383  POZ-AT hook zinc finger protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    23598 (PATZ1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    23598 (PATZ1)
SSDB
Motif
Pfam: zf-C2H2_assoc3 zf-C2H2_4 zf-C2H2 BTB zf-H2C2_2 zf-C2H2_jaz zf-met zf-C2H2_6 zf-Di19 zf-C2H2_3rep Zn-ribbon_8 ARS2 zf-C2H2_8 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 23598
NCBI-ProteinID: NP_055138
OMIM: 605165
HGNC: 13071
Ensembl: ENSG00000100105
Vega: OTTHUMG00000151254
Pharos: Q9HBE1(Tbio)
UniProt: Q9HBE1 A0A024R1M5
Structure
PDB: 
2YT9 2EPP 2EPQ 2EPR 2EPS

Position
22q12.2
AA seq 687 aa
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggagcgggtgaacgacgcttcgtgcggcccgtctggctgctacacataccaggtgagc
agacacagcacggagatgctgcacaacctgaaccagcagcgcaaaaacggcgggcgcttc
tgcgacgtgctcttgcgggtaggcgacgagagcttcccagcgcaccgcgccgtgctggcc
gcctgcagcgagtactttgagtcggtgttcagcgcccagttgggcgacggcggagctgcg
gacgggggtccggctgatgtagggggcgcgacggcagcaccaggcggcggggccgggggc
agccgggagctggagatgcacactatcagctccaaggtatttggggacattctggacttc
gcctacacttcccgcatcgtggtgcgcttggagagctttcccgaactcatgacggccgcc
aagttcctgctgatgaggtcggttatcgagatctgccaggaagtcatcaaacagtccaac
gtacagatcctggtaccccctgcccgcgccgatataatgctctttcgcccccctgggacc
tcggacttgggcttccctttggacatgaccaacggggcagccttggcagccaacagcaat
ggcatcgccggcagcatgcagccagaggaggaggcagctcgggcggctggtgcagccatt
gcaggccaagcctctttgcctgtgttacctggggtggaccgcttgcccatggtggctgga
cccctatccccccaactgctgacttccccattccccagtgtggcatccagtgcccctccc
ctgactggcaagcgaggccggggccgcccaaggaaggccaacctgctggactcaatgttt
gggtccccagggggcctgagggaggcaggcatccttccatgcggtctatgtggtaaggtg
ttcactgatgccaaccggctccggcagcacgaggcccagcacggtgtcaccagcctccag
ctgggctacatcgaccttcctcctccgaggctgggtgagaatgggctacccatctctgaa
gaccccgacggcccccgaaagaggagccggaccaggaagcaggtggcttgtgagatctgc
ggcaagatcttccgtgatgtgtatcatcttaaccggcacaagctgtcccactctggggag
aagccctactcctgccctgtgtgtgggttgcggttcaagagaaaagaccgcatgtcctac
catgtgcggtcccatgatgggtccgtgggcaagccttacatctgccagagctgtgggaaa
ggcttctccaggcctgatcacttgaacggacatatcaagcaggtgcacacttctgagcgg
cctcacaagtgtcagacctgcaatgcttcttttgccacccgagaccgtctgcgctcccac
ctggcctgtcatgaagacaaggtgccctgccaggtgtgtgggaagtacttgcgggcagca
tacatggcagaccacctgaagaagcacagcgaggggcccagcaacttctgcagtatctgt
aaccgaggtttctcctctgcctcctacttaaaggtccatgttaaaacccaccacggtgtt
ccccttccccaggtctccaggcaccaggagcccatcctgaatgggggagcagcgttccac
tgcgccaggacctatggcaacaaagaaggccagaaatgctcacatcaggatccgattgag
agctctgactcctatggtgacctctcagatgccagcgacctgaagacgccagagaagcag
agtgccaatggctctttctcctgcgacatggcagtccccaaaaacaaaatggagtctgat
ggggagaagaagtacccatgccctgaatgtgggagcttcttccgctctaagtcctacttg
aacaaacacatccagaaggtgcatgtccgggctctcgggggccccctgggggacctgggc
cctgcccttggctcacctttctctcctcagcagaacatgtctctcctcgagtcctttggg
tttcagattgttcagtcggcatttgcgtcatctttagtagatcctgaggttgaccagcag
cccatggggcctgaagggaaatga

DBGET integrated database retrieval system