KEGG   Homo sapiens (human): 23601
Entry
23601             CDS       T01001                                 

Gene name
CLEC5A, CLECSF5, MDL-1, MDL1
Definition
(RefSeq) C-type lectin domain containing 5A
  KO
K10073  C-type lectin domain family 5 member A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    23601 (CLEC5A)
   04091 Lectins [BR:hsa04091]
    23601 (CLEC5A)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   23601 (CLEC5A)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   23601 (CLEC5A)
SSDB
Motif
Pfam: Lectin_C CRISPR_Cas2
Other DBs
NCBI-GeneID: 23601
NCBI-ProteinID: NP_037384
OMIM: 604987
HGNC: 2054
Ensembl: ENSG00000258227
Vega: OTTHUMG00000157173
Pharos: Q9NY25(Tbio)
UniProt: Q9NY25 A4D1U7
Structure
PDB: 
2YHF

Position
7q34
AA seq 188 aa
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNG
FITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
ITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYR
RICEKNAK
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaactggcacatgatcatctctgggcttattgtggtagtgcttaaagttgttggaatg
accttatttctactttatttcccacagatttttaacaaaagtaacgatggtttcaccacc
accaggagctatggaacagtctcacagatttttgggagcagttccccaagtcccaacggc
ttcattaccacaaggagctatggaacagtctgccccaaagactgggaattttatcaagca
agatgttttttcttatccacttctgaatcatcttggaatgaaagcagggacttttgcaaa
ggaaaaggatccacattggcaattgtcaacacgccagagaaactgaagtttcttcaggac
ataactgatgctgagaagtattttattggcttaatttaccatcgtgaagagaaaaggtgg
cgttggatcaacaactctgtgttcaatggcaatgttaccaatcagaatcagaatttcaac
tgtgcgaccattggcctaacaaagacatttgatgctgcatcatgtgacatcagctaccgc
aggatctgtgagaagaatgccaaatga

DBGET integrated database retrieval system