KEGG   Homo sapiens (human): 23603
Entry
23603             CDS       T01001                                 
Symbol
CORO1C, HCRNN4
Name
(RefSeq) coronin 1C
  KO
K13886  coronin-1B/1C/6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23603 (CORO1C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     23603 (CORO1C)
SSDB
Motif
Pfam: DUF1899 WD40_4 WD40 ANAPC4_WD40 NBCH_WD40 eIF2A MetOD2 Methyltransf_15
Other DBs
NCBI-GeneID: 23603
NCBI-ProteinID: NP_001263400
OMIM: 605269
HGNC: 2254
Ensembl: ENSG00000110880
Pharos: Q9ULV4(Tbio)
UniProt: Q9ULV4 A0A024RBI5
Structure
Position
12:complement(108645109..108731518)
AA seq 474 aa
MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLV
LPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLT
EPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNV
SWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRM
SERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESP
YVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDD
LYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKC
DLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaggcgagtggtacgacagagcaagtttcggcatgtatttgggcaagcggtgaaaaat
gaccagtgctatgatgacatccgggtttctcgtgtgacctgggatagttccttttgtgct
gtcaatcccagatttgttgccataatcatagaggcaagtgggggaggagcgttccttgtc
ctccctctgcacaagactggtcgaattgacaaatcttaccctacagtatgtggccacaca
ggaccagtgctggacatagactggtgcccacataacgatcaggtcattgccagcggttca
gaggactgcacggtcatggtatggcagatcccagaaaatggactcaccctttccctgact
gaacctgtggtgattttggaaggccactcaaagagagtcggcatcgtggcttggcatcca
acggcccgcaatgtgcttcttagtgcaggctgtgataatgccattatcatctggaatgtg
ggaacaggggaagcccttataaacttggacgatatgcattcagacatgatttacaatgtg
agctggaaccggaatggcagtctgatctgcacagcttccaaagacaagaaagtgagagtc
attgatcccaggaaacaagagattgttgctgagaaggagaaagcacatgaaggagcaaga
cccatgagagccatcttcctggccgatggcaatgtcttcaccactgggttcagccgcatg
agcgagcggcagctggctctctggaatccgaaaaatatgcaggaaccaattgctcttcat
gagatggacactagcaatggggtgttgctgcctttctatgaccctgacaccagcatcatt
tacttatgtggaaagggtgacagcagtattcgctattttgagatcacggatgaatccccg
tacgtccactacctcaacacattcagcagcaaggagcctcagagagggatgggttacatg
cccaagaggggacttgatgttaacaaatgtgagattgccagattcttcaaacttcatgag
agaaagtgtgaacctattattatgactgttcccaggaagtctgaccttttccaagatgac
ctgtatcctgacacagcggggccagaggccgcgctggaggcagaagagtggttcgaaggc
aagaatgcagacccaatcctcatctccttgaagcacgggtacattccaggcaaaaacagg
gatctcaaggtggtcaagaagaacattctggatagcaagcccactgcaaacaagaagtgc
gacctgatcagcatccccaagaaaaccacagacacggccagtgtgcaaaatgaagccaag
ttggatgagattttaaaagagatcaaatctataaaagacacaatctgcaatcaagatgag
cgtatttccaagttagaacagcagatggcaaagatagcagcctga

DBGET integrated database retrieval system