KEGG   Homo sapiens (human): 23604Help
Entry
23604             CDS       T01001                                 

Gene name
DAPK2, DRP-1, DRP1
Definition
(RefSeq) death associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    23604 (DAPK2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23604 (DAPK2)
   05219 Bladder cancer
    23604 (DAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23604 (DAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   23604 (DAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kdo Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 23604
NCBI-ProteinID: NP_055141
OMIM: 616567
HGNC: 2675
Ensembl: ENSG00000035664
Vega: OTTHUMG00000132947
Pharos: Q9UIK4(Tchem)
UniProt: Q9UIK4 A0A024R603
Structure
PDB: 

Position
15q22.31
AA seq 370 aa AA seqDB search
MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcctcaatgaggagtccaaacatggagccattcaagcagcagaaggtggag
gacttttatgacatcggagaggagctggggagtggccagtttgccatcgtgaagaagtgc
cgggagaagagcacggggcttgagtatgcagccaagttcatcaagaagcggcagagccgg
gcgagccggcgcggtgtgagccgggaggagatcgagcgggaggtgagcatcctgcggcag
gtgctgcaccacaatgtcatcacgctgcacgacgtctatgagaaccgcaccgacgtggtg
ctcatccttgagctagtgtctggaggagagctcttcgatttcctggcccagaaggagtca
ctgagtgaggaggaggccaccagcttcattaagcagatcctggatggggtgaactacctt
cacacaaagaaaattgctcactttgatctcaagccagaaaacattatgttgttagacaag
aatattcccattccacacatcaagctgattgactttggtctggctcacgaaatagaagat
ggagttgaatttaagaatatttttgggacgccggaatttgttgctccagaaattgtgaac
tacgagcccctgggtctggaggctgacatgtggagcataggcgtcatcacctacatcctc
ttaagtggagcatcccctttcctgggagacacgaagcaggaaacactggcaaatatcaca
gcagtgagttacgactttgatgaggaattcttcagccagacgagcgagctggccaaggac
tttattcggaagcttctggttaaagagacccggaaacggctcacaatccaagaggctctc
agacacccctggatcacgccggtggacaaccagcaagccatggtgcgcagggagtctgtg
gtcaatctggagaacttcaggaagcagtatgtccgcaggcggtggaagctttccttcagc
atcgtgtccctgtgcaaccacctcacccgctcgctgatgaagaaggtgcacctgaggccg
gatgaggacctgaggaactgtgagagtgacactgaggaggacatcgccaggaggaaagcc
ctccacccacggaggaggagcagcacctcctaa

DBGET integrated database retrieval system