KEGG   Homo sapiens (human): 23608Help
Entry
23608             CDS       T01001                                 

Gene name
MKRN1, RNF61
Definition
(RefSeq) makorin ring finger protein 1
  KO
K15687  E3 ubiquitin-protein ligase makorin [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23608 (MKRN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23608 (MKRN1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23608 (MKRN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MKRN1_C zf-CCCH_4 zf-CCCH Torus zf_CCCH_4 zf-C3HC4 zf-CCCH_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-CCCH_2 zf-ANAPC11 zf-rbx1 zf-C3HC4_4 zf-RING_11 zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 23608
NCBI-ProteinID: NP_038474
OMIM: 607754
HGNC: 7112
Ensembl: ENSG00000133606
Vega: OTTHUMG00000157412
Pharos: Q9UHC7(Tbio)
UniProt: Q9UHC7
Position
7q34
AA seq 482 aa AA seqDB search
MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVT
CRYFMHGVCKEGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATAT
ELTTKSSLAASSSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCG
RTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCG
LQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG
ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILK
YKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDL
DL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctgcaactcccggaacaacagccacaacatcaggagcaggagcggcagcg
gcgacggcggcagcagcctcccccaccccgatccccacagtcaccgccccgtccctgggg
gcgggcggagggggcggcggcagcgacggcagcggcggcggctggactaaacaggtcacc
tgcaggtattttatgcatggggtttgtaaggaaggagacaactgtcgctactcgcatgac
ctctctgacagtccgtatagtgtagtgtgcaagtattttcagcgagggtactgtatttat
ggagaccgctgcagatatgaacatagcaaaccattgaaacaggaagaagcaactgctaca
gagctaactacaaagtcatcccttgctgcttcctcaagtctctcatcgatagttggacca
cttgttgaaatgaatacaggcgaagctgagtcaagaaattcaaactttgcaactgtagga
gcaggttcagaggactgggtgaatgctattgagtttgttcctgggcaaccctactgtggc
cgtactgcgccttcctgcactgaagcacccctgcagggctcagtgaccaaggaagaatca
gagaaagagcaaaccgccgtggagacaaagaagcagctgtgcccctatgctgcagtggga
gagtgccgatacggggagaactgtgtgtatctccacggagattcttgtgacatgtgtggg
ctgcaggtcctgcatccaatggatgctgcccagagatcgcagcatatcaaatcgtgcatt
gaggcccatgagaaggacatggagctctcatttgccgtgcagcgcagcaaggacatggtg
tgtgggatctgcatggaggtggtctatgagaaagccaaccccagtgagcgccgcttcggg
atcctctccaactgcaaccacacctactgtctcaagtgcattcgcaagtggaggagtgct
aagcaatttgagagcaagatcataaagtcctgcccagaatgccggatcacatctaacttt
gtcattccaagtgagtactgggtggaggagaaagaagagaagcagaaactcattctgaaa
tacaaggaggcaatgagcaacaaggcgtgcaggtattttgatgaaggacgtgggagctgc
ccatttggagggaactgtttttacaagcatgcgtaccctgatggccgtagagaggagcca
cagagacagaaagtgggaacatcaagcagataccgggcccaacgaaggaaccacttctgg
gaactcattgaggaaagagagaacagcaacccctttgacaacgatgaagaagaggttgtc
acctttgagctgggcgagatgttgcttatgcttttggctgcaggtggggacgacgaacta
acagactctgaagatgagtgggacttgtttcatgatgagctggaagatttttatgacttg
gatctatag

DBGET integrated database retrieval system