KEGG   Homo sapiens (human): 23613
Entry
23613             CDS       T01001                                 

Gene name
ZMYND8, PRKCBP1, PRO2893, RACK7
Definition
(RefSeq) zinc finger MYND-type containing 8
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF3544 Bromodomain PHD PWWP zf-MYND DUF1640
Other DBs
NCBI-GeneID: 23613
NCBI-ProteinID: NP_001268701
OMIM: 615713
HGNC: 9397
Ensembl: ENSG00000101040
Vega: OTTHUMG00000032667
Pharos: Q9ULU4(Tbio)
UniProt: Q9ULU4 A6H8Y8
Structure
PDB: 
4COS 5B73 5Y1Z 5MQ4

Position
20q13.12
AA seq 1186 aa
MFSSLQKSFNLAEEEIKTEQEVVEGMDISTRSKDPGSAERTAQKRKFPSPPHSSNGHSPQ
DTSTSPIKKKKKPGLLNSNNKEQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSE
PEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLE
QHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKV
VIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKD
GQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVF
NYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLNFDMTASPKILMSKPVLSGGT
GRRISLSDMPRSPMSTNSSVHTGSDVEQDAEKKATSSHFSASEESMDFLDKSTASPASTK
TGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQS
TPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDS
EYISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADP
GAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGED
HSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTS
TSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQ
QQQQQQQNQQQQPQSSQGTRYQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSG
SMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEI
RRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD
ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTE
TLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQG
SDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESRLDTFWD
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgttttcatcgctgcagaaatccttcaacttggctgaagaggaaataaaaacagaacag
gaggtggtagagggcatggatatctctactcgctccaaagatcctggctctgcagagaga
acagcccagaaaagaaagttccccagccctccacattcttccaatggccactcgccgcag
gacacatcaacaagccccattaaaaagaaaaagaaacctggcttactgaacagtaacaat
aaggagcaggatggacggaatgatttctactgctgggtttgtcaccgggaaggccaagtc
ctttgctgtgagctctgtccccgggtttatcacgctaagtgtctgagactgacatcggaa
ccagagggggactggttttgtcctgaatgtgagaaaattacagtagcagaatgcatcgag
acccagagtaaagccatgacaatgctcaccattgaacagttatcctacctgctcaagttt
gccattcagaaaatgaaacagccagggacagatgcattccagaagcccgttccattggaa
cagcaccctgactatgcggaatacatcttccatccaatggacctttgtacattggaaaag
aatgcgaaaaagaaaatgtatggctgcacagaagccttcctggctgatgcaaagtggatt
ttgcacaactgcatcatttataatgggggaaatcacaaattgacgcaaatagcgaaagta
gtcatcaaaatctgtgaacatgagatgaatgaaatcgaagtatgtccagaatgttatcta
gctgcttgccaaaaacgagataactggttttgtgagccttgtagcaatccacatcctttg
gtctgggccaaactgaaggggtttccattctggcctgcaaaagctctaagggataaagac
gggcaggtcgatgcccgattctttggacaacatgacagggcctgggttccaataaataat
tgctacctcatgtctaaagaaattcctttttctgtgaaaaagactaagagcatcttcaac
agtgccatgcaagagatggaggtttacgtggagaacatccgcaggaagtttggggttttt
aattactctccatttaggacaccctacacacccaacagccagtatcaaatgctgctcgat
cccaccaaccccagcgccggcactgccaagatagacaagcaggagaaggtcaagctcaac
tttgacatgacggcatcccccaagatcctgatgagcaagcctgtgctgagtgggggcaca
ggccgccggatttccttgtcggatatgccgcgctcccccatgagcacaaactcttctgtg
cacacgggctccgacgtggagcaggatgctgagaagaaggccacgtcgagccacttcagt
gcgagcgaggagtccatggacttcctggataagagcacagcttcaccagcctccaccaag
acgggacaagcagggagtttatccggcagcccaaagcccttctctcctcaactgtcagct
cctatcacgacgaaaacggacaaaacctccaccaccggcagcatcctgaatcttaacctg
gatcgaagcaaagctgagatggatttgaaggagctgagcgagtcggtccagcaacagtcc
acccctgttcctctcatctctcccaagcgccagattcgtagcaggttccagctgaatctt
gacaagaccatagagagttgcaaagcacaattaggcataaatgaaatctcggaagatgtc
tatacggccgtagagcacagcgattcggaggattctgagaagtcagatagtagcgatagt
gagtatatcagtgatgatgagcagaagtctaagaacgagccagaagacacagaggacaaa
gaaggttgtcagatggacaaagagccatctgctgttaaaaaaaagcccaagcctacaaac
ccagtggagattaaagaggagctgaaaagcacgtcaccagccagcgagaaggcagaccct
ggagcagtcaaggacaaggccagccctgagcctgagaaggacttttccgaaaaggcaaaa
ccttcacctcaccccataaaggataaactgaagggaaaagatgagacggattccccaaca
gtccatttgggcctggactctgattcagagagcgaacttgtcatagatttaggagaagac
cattctgggcgggagggtcgaaaaaataagaaggaacccaaagaaccatctcccaaacag
gatgttgtaggtaaaactccaccatccacgacggtgggcagccattctcccccggaaaca
ccggtgctcacccgctcttccgcccaaacttccgcggctggcgccacagccaccaccagc
acgtcctccacggtcaccgtcacggccccggcccccgccgccacaggaagcccagtgaaa
aagcagaggccgcttttaccgaaggagactgccccggccgtgcagcgggtcgtgtggaac
tcatcaagtaagtttcaaacgtcctcccaaaagtggcacatgcagaagatgcagcgtcag
cagcagcagcagcagcagcaaaaccagcagcagcagcctcagtcttcccaggggacgaga
tatcagaccagacaggctgtgaaagctgtccagcagaaggagatcacacagagcccatcc
acgtccaccatcaccctggtgaccagcacacagtcatcgcccctggtcaccagctcgggg
tccatgagcacccttgtgtcctcagtcaacgctgacctgcccatcgccactgcctcagct
gatgtcgccgctgatattgccaagtacactagcaaaatgatggatgcaataaaaggaaca
atgacagaaatatacaacgatctttctaaaaacactactggaagcacaatagctgagatt
cgcaggctgaggatcgagatagagaagctccagtggctgcaccagcaagagctctccgaa
atgaaacacaacttagagctgaccatggcggagatgcggcagagcctggagcaggagcgg
gaccggctcatcgccgaggtgaagaagcagctggagttggagaagcagcaggcggtggat
gagaccaagaagaagcagtggtgcgccaactgcaagaaggaggccatcttttactgctgt
tggaacaccagctactgtgactacccctgccagcaagcccactggcctgagcacatgaag
tcctgcacccagtcagctactgctcctcagcaggaagcggatgctgaggtgaacacagaa
acactaaataagtcctcccaggggagctcctcgagcacacaatcagcaccttcagaaacg
gccagcgcctccaaagagaaggagacgtcagctgagaaaagcaaggagagtggctcgacc
cttgacctttctggctccagagagacgccctcctccattctcttaggctccaaccaaggc
tctgaccattcccggagtaataaatccagttggagcagcagtgatgagaagaggggatcg
acacgttccgatcacaacaccagtaccagcacgaagagcctcctcccgaaagagtctcgg
ctggacaccttctgggactag

DBGET integrated database retrieval system