KEGG   Homo sapiens (human): 23620Help
Entry
23620             CDS       T01001                                 

Gene name
NTSR2, NTR2
Definition
(RefSeq) neurotensin receptor 2
  KO
K04212  neurotensin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23620 (NTSR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neurotensin
    23620 (NTSR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 23620
NCBI-ProteinID: NP_036476
OMIM: 605538
HGNC: 8040
Ensembl: ENSG00000169006
Vega: OTTHUMG00000119083
Pharos: O95665(Tchem)
UniProt: O95665
Position
2p25.1
AA seq 410 aa AA seqDB search
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSVHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccagcagcccgcggcccccgcggcccagctccaacccggggctgagcctggac
gcccggctgggcgtggacactcgcctctgggccaaggtgctgttcaccgcgctctacgca
ctcatctgggcgctgggcgcggcgggcaatgcgctgtccgtgcacgtggtgctgaaggcg
cgggccgggcgcgcggggcgcctgcgccaccacgtgctcagcctggcgctcgcgggcctg
ctgctgctgctggtcggcgtgccggtggagctctacagcttcgtgtggttccactacccc
tgggtcttcggcgacctgggctgccgcggctactacttcgtgcacgagctgtgcgcctac
gccacggtgctgagcgtggcaggcctgagcgccgagcgctgcctagccgtgtgccagccc
ctgcgtgcccgcagcctgctgacgccacgccggacccggtggctggtggcgctctcgtgg
gccgcctcgctcggcctcgccctgcccatggccgtcatcatggggcagaagcacgaactc
gagacggcggacggggagccggagcccgcctcgcgagtgtgcacggtgctggtgagccgc
accgcgctccaagtctttatccaggtgaatgtgctggtgtccttcgtgctccccttggca
ctaactgctttcctgaatggggtcacagtgagccacctgctggccctctgctcccaagtg
ccgtccacttctaccccgggcagctccacccccagccgcctggagctgctgagtgaggag
ggtctcctcagcttcatcgtatggaagaagacctttatccagggaggccaggtcagcctg
gtgagacataaagacgtgcgccggatccgcagcctccagcgcagcgtccaggttctcaga
gccatcgtggtcatgtatgtcatctgctggctgccgtaccatgcccgcaggctcatgtac
tgctacgtacctgatgacgcgtggactgacccactgtacaatttctaccactacttctac
atggtgaccaacacacttttctacgtcagctcagctgtgactcctcttctctacaacgcc
gtgtcctcctccttcagaaaactcttcctggaagccgtcagctccctgtgtggagagcac
caccccatgaagcggttacccccgaagccccagagtcccaccctaatggatacagcttca
ggctttggggatcccccagaaacccggacctga

DBGET integrated database retrieval system