KEGG   Homo sapiens (human): 23624Help
Entry
23624             CDS       T01001                                 

Gene name
CBLC, CBL-3, CBL-SL, RNF57
Definition
(RefSeq) Cbl proto-oncogene C
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23624 (CBLC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23624 (CBLC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23624 (CBLC)
   04121 Ubiquitin system [BR:hsa04121]
    23624 (CBLC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23624 (CBLC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    23624 (CBLC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    23624 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX SH2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 23624
NCBI-ProteinID: NP_036248
OMIM: 608453
HGNC: 15961
Ensembl: ENSG00000142273
Vega: OTTHUMG00000150715
Pharos: Q9ULV8(Tbio)
UniProt: Q9ULV8
Structure
PDB: 

Position
19q13.32
AA seq 474 aa AA seqDB search
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcggtggccccgtgggggcgacagtgggaagaggcccgcgccctgggccgg
gcagtcaggatgctgcagcgcctagaagagcaatgcgtcgacccccggctgtccgtgagt
cccccttcgctgcgggacctgctgccccgcacagcgcagctgcttcgagaggtggcccat
tctcggcgggcggccggcggaggcggccccgggggtcccggcggctctggggactttcta
ctcatctacctggccaatctggaggccaagagcaggcaggtggccgcgctgctgcctccc
cggggccgaaggagtgccaacgacgagctcttccgggcgggctccagactcaggcgacag
ctggccaagctggccatcatcttcagccacatgcacgcagagctgcacgcactcttcccc
gggggaaagtactgtggacacatgtaccagctcaccaaggcccccgcccacaccttctgg
agggaaagttgcggagcccggtgtgtgctgccctgggctgagtttgagtccctcctgggc
acctgccaccctgtggaaccaggctgcacagccctggccttgcgcaccaccattgacctc
acctgcagcgggcacgtgtccatcttcgagttcgacgtcttcaccaggctctttcagcca
tggccaacactcctcaagaactggcagctcctggcagtcaaccacccaggctacatggcc
ttcctcacctatgatgaggtccaagagcgtctgcaggcctgcagggacaagccaggcagt
tacatcttccggcccagctgtactcgcctggggcagtgggccatcggctatgtgagctca
gatggcagcatcctgcagaccatccctgccaacaaacccctgtcccaggtgctcctggag
ggacagaaggacggcttctacctctacccagatggaaagacccacaacccagacctgact
gagctcggccaggcagaaccccagcagcgcatccacgtgtcagaggagcagctgcagctc
tactgggccatggactccacatttgagctctgcaagatctgtgctgagagcaacaaggat
gtgaagattgagccgtgcgggcacctgctctgcagctgctgcctggctgcctggcagcac
tcggacagccagacctgccccttctgccgctgcgagatcaagggctgggaggccgtgagt
atctaccagttccacggtcaggctactgctgaggactcagggaacagcagtgaccaggaa
ggcagggagttggagctggggcaggtgcccctttcggctcctccattgcccccacggcca
gatctgccccccaggaagcccagaaatgcccagccgaaagtgagactcctaaaggggaac
tcccctccagctgcgctgggaccccaggaccctgccccggcctga

DBGET integrated database retrieval system