KEGG   Homo sapiens (human): 23624Help
Entry
23624             CDS       T01001                                 

Gene name
CBLC, CBL-3, CBL-SL, RNF57
Definition
(RefSeq) Cbl proto-oncogene C
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23624 (CBLC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23624 (CBLC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23624 (CBLC)
   04121 Ubiquitin system [BR:hsa04121]
    23624 (CBLC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23624 (CBLC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    23624 (CBLC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    23624 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX SH2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 23624
NCBI-ProteinID: NP_036248
OMIM: 608453
HGNC: 15961
Ensembl: ENSG00000142273
Vega: OTTHUMG00000150715
Pharos: Q9ULV8(Tbio)
UniProt: Q9ULV8
Structure
PDB: 

Position
19q13.32
AA seq 474 aa AA seqDB search
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcggtggccccgtgggggcgacagtgggaagaggcccgcgccctgggccgg
gcagtcaggatgctgcagcgcctagaagagcaatgcgtcgacccccggctgtccgtgagt
cccccttcgctgcgggacctgctgccccgcacagcgcagctgcttcgagaggtggcccat
tctcggcgggcggccggcggaggcggccccgggggtcccggcggctctggggactttcta
ctcatctacctggccaatctggaggccaagagcaggcaggtggccgcgctgctgcctccc
cggggccgaaggagtgccaacgacgagctcttccgggcgggctccagactcaggcgacag
ctggccaagctggccatcatcttcagccacatgcacgcagagctgcacgcactcttcccc
gggggaaagtactgtggacacatgtaccagctcaccaaggcccccgcccacaccttctgg
agggaaagttgcggagcccggtgtgtgctgccctgggctgagtttgagtccctcctgggc
acctgccaccctgtggaaccaggctgcacagccctggccttgcgcaccaccattgacctc
acctgcagcgggcacgtgtccatcttcgagttcgacgtcttcaccaggctctttcagcca
tggccaacactcctcaagaactggcagctcctggcagtcaaccacccaggctacatggcc
ttcctcacctatgatgaggtccaagagcgtctgcaggcctgcagggacaagccaggcagt
tacatcttccggcccagctgtactcgcctggggcagtgggccatcggctatgtgagctca
gatggcagcatcctgcagaccatccctgccaacaaacccctgtcccaggtgctcctggag
ggacagaaggacggcttctacctctacccagatggaaagacccacaacccagacctgact
gagctcggccaggcagaaccccagcagcgcatccacgtgtcagaggagcagctgcagctc
tactgggccatggactccacatttgagctctgcaagatctgtgctgagagcaacaaggat
gtgaagattgagccgtgcgggcacctgctctgcagctgctgcctggctgcctggcagcac
tcggacagccagacctgccccttctgccgctgcgagatcaagggctgggaggccgtgagt
atctaccagttccacggtcaggctactgctgaggactcagggaacagcagtgaccaggaa
ggcagggagttggagctggggcaggtgcccctttcggctcctccattgcccccacggcca
gatctgccccccaggaagcccagaaatgcccagccgaaagtgagactcctaaaggggaac
tcccctccagctgcgctgggaccccaggaccctgccccggcctga

KEGG   Homo sapiens (human): 867Help
Entry
867               CDS       T01001                                 

Gene name
CBL, C-CBL, CBL2, FRA11B, NSLL, RNF55
Definition
(RefSeq) Cbl proto-oncogene
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04910  Insulin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05220  Chronic myeloid leukemia
Network
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
Disease
H00523  Noonan syndrome and related disorders
H02190  CBL syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    867 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    867 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    867 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    867 (CBL)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    867 (CBL)
   05205 Proteoglycans in cancer
    867 (CBL)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    867 (CBL)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    867 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    867 (CBL)
   04121 Ubiquitin system [BR:hsa04121]
    867 (CBL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     867 (CBL)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    867 (CBL)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    867 (CBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 867
NCBI-ProteinID: NP_005179
OMIM: 165360
HGNC: 1541
Ensembl: ENSG00000110395
Vega: OTTHUMG00000166170
Pharos: P22681(Tbio)
UniProt: P22681
Structure
PDB: 

Position
11q23.3
AA seq 906 aa AA seqDB search
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggag
aatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttcgg
attactaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacaatagtc
ccttggaagagctttcgacaggctctacatgaagtgcatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaa
tttgacatctttacccgactctttcagccctggtcctctttgctcaggaattggaacagc
cttgctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccat
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaacta
tgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccga
tgtgaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattatgatgatgatgatgat
gaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacgg
ccgccttctccattctccatggccccacaagcttcccttcccccggtgccaccacgactt
gaccttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttct
aaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcga
gatcttccaccaccaccgcctccagaccggccatattctgttggagcagaatcccgacct
caaagacgccccttgccttgtacaccaggcgactgtccctccagagacaaactgccccct
gtcccctctagccgccttggagactcatggctgccccggccaatccccaaagtaccagta
tctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcactcactt
ccattttcattgccctcacaaatggagcccagaccagatgtgcctaggctcggaagcacg
ttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagagtgtgac
caccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacct
cttcctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtac
atgactccctcttccaggcctctacggcctttggatacatcccagagttcacgagcatgt
gattgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccag
gcgccatctatcaccgagagcagcacctttggtgaagggaatttggccgcagcccatgcc
aacactggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacct
gtgccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctccttt
ggctggttgtctctggatggtgatcctacaacaaatgtcactgaaggttcccaagttccc
gagaggcctccaaaaccattcccgcggagaatcaactctgaacggaaagctggcagctgt
cagcaaggtagtggtcctgccgcctctgctgccaccgcctcacctcagctctccagtgag
atcgagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcatt
gcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttct
cctgcccatgtagctacctag

KEGG   Homo sapiens (human): 868Help
Entry
868               CDS       T01001                                 

Gene name
CBLB, Cbl-b, Nbla00127, RNF56
Definition
(RefSeq) Cbl proto-oncogene B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04910  Insulin signaling pathway
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    868 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    868 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    868 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    868 (CBLB)
   04660 T cell receptor signaling pathway
    868 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    868 (CBLB)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    868 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    868 (CBLB)
   04121 Ubiquitin system [BR:hsa04121]
    868 (CBLB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     868 (CBLB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    868 (CBLB)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    868 (CBLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-rbx1 UBA zf-RING_4
Motif
Other DBs
NCBI-GeneID: 868
NCBI-ProteinID: NP_001308717
OMIM: 604491
HGNC: 1542
Ensembl: ENSG00000114423
Vega: OTTHUMG00000150654
Pharos: Q13191(Tbio)
UniProt: Q13191
Structure
PDB: 

Position
3q13.11
AA seq 982 aa AA seqDB search
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcaatgaatggcagaaaccctggtggtcgaggaggaaatccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcc
gcagatcgcaggaccgtggagaagacttggaagctcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatattgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaaatcaaagcaatc
tttcccaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactatcgtaccatggaaagtattcagacagtgc
cttcatgaggtccaccagattagctctggcctggaagcaatggctctaaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccaggttac
atggcatttctcacatatgatgaagttaaagcacgactacagaaatatagcaccaaaccc
ggaagctatattttccggttaagttgcactcgattgggacagtgggccattggctatgtg
actggggatgggaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgaccatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaatgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacggcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggctccaggtgttgcagcatcattgac
ccctttggcatgccgatgctagacttggacgacgatgatgatcgtgaggagtccttgatg
atgaatcggttggcaaacgtccgaaagtgcactgacaggcagaactcaccagtcacatca
ccaggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccacccgtgcctcctcgcctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaacgggttcaccaaagtcttctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagagatcctcctccaccgccacctgaa
agacctccaccaatcccaccagacaatagactgagtagacacatccatcatgtggaaagc
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgggatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggggagggctctccaaaacctggaatcaca
gcgagttcaaatgtcaatggaaggcacagtagagtgggctctgacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggagctaaggtcttttccaatggtcacctt
ggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagttaccaccctc
ctccctagcataaagtgtactggtccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagatgatgatgaatacaagattccttcatcccaccctgtttccctgaat
tcacaaccatctcattgtcataatgtaaaacctcctgttcggtcttgtgataatggtcac
tgtatgctgaatggaacacatggtccatcttcagagaagaaatcaaacatccctgactta
agcatatatttaaagggagatgtttttgattcagcctctgatcccgtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgccctccctccatct
ctcccacctcccccacctcctgcaaggcatagtctcattgaacattcaaaacctcctggc
tccagtagccggccatcctcaggacaggatctttttcttcttccttcagatccctttgtt
gatctagcaagtggccaagttcctttgcctcctgctagaaggttaccaggtgaaaatgtc
aaaactaacagaacatcacaggactatgatcagcttccttcatgttcagatggttcacag
gcaccagccagaccccctaaaccacgaccgcgcaggactgcaccagaaattcaccacaga
aaaccccatgggcctgaggcggcattggaaaatgtcgatgcaaaaattgcaaaactcatg
ggagagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgtc
gaagttgcccggagcatcctccgagaatttgccttccctcctccagtatccccacgtcta
aatctatag

DBGET integrated database retrieval system