KEGG   Homo sapiens (human): 23632Help
Entry
23632             CDS       T01001                                 

Gene name
CA14, CAXiV
Definition
(RefSeq) carbonic anhydrase 14
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    23632 (CA14)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     23632 (CA14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase NicO
Motif
Other DBs
NCBI-GeneID: 23632
NCBI-ProteinID: NP_036245
OMIM: 604832
HGNC: 1372
Ensembl: ENSG00000118298
Vega: OTTHUMG00000012549
Pharos: Q9ULX7(Tclin)
UniProt: Q9ULX7 A8K3J4
Structure
PDB: 

Position
1q21.2
AA seq 337 aa AA seqDB search
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttgttctccgccctcctgctggaggtgatttggatcctggctgcagatgggggtcaa
cactggacgtatgagggcccacatggtcaggaccattggccagcctcttaccctgagtgt
ggaaacaatgcccagtcgcccatcgatattcagacagacagtgtgacatttgaccctgat
ttgcctgctctgcagccccacggatatgaccagcctggcaccgagcctttggacctgcac
aacaatggccacacagtgcaactctctctgccctctaccctgtatctgggtggacttccc
cgaaaatatgtagctgcccagctccacctgcactggggtcagaaaggatccccagggggg
tcagaacaccagatcaacagtgaagccacatttgcagagctccacattgtacattatgac
tctgattcctatgacagcttgagtgaggctgctgagaggcctcagggcctggctgtcctg
ggcatcctaattgaggtgggtgagactaagaatatagcttatgaacacattctgagtcac
ttgcatgaagtcaggcataaagatcagaagacctcagtgcctcccttcaacctaagagag
ctgctccccaaacagctggggcagtacttccgctacaatggctcgctcacaactccccct
tgctaccagagtgtgctctggacagttttttatagaaggtcccagatttcaatggaacag
ctggaaaagcttcaggggacattgttctccacagaagaggagccctctaagcttctggta
cagaactaccgagcccttcagcctctcaatcagcgcatggtctttgcttctttcatccaa
gcaggatcctcgtataccacaggtgaaatgctgagtctaggtgtaggaatcttggttggc
tgtctctgccttctcctggctgtttatttcattgctagaaagattcggaagaagaggctg
gaaaaccgaaagagtgtggtcttcacctcagcacaagccacgactgaggcataa

DBGET integrated database retrieval system