KEGG   Homo sapiens (human): 23633Help
Entry
23633             CDS       T01001                                 

Gene name
KPNA6, IPOA7, KPNA7
Definition
(RefSeq) karyopherin subunit alpha 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C RICTOR_V Arm_2
Motif
Other DBs
NCBI-GeneID: 23633
NCBI-ProteinID: NP_036448
OMIM: 610563
HGNC: 6399
Ensembl: ENSG00000025800
Vega: OTTHUMG00000004333
Pharos: O60684(Tbio)
UniProt: O60684
Structure
PDB: 

Position
1p35.2
AA seq 536 aa AA seqDB search
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA
AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI
NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF
EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRG
KNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTI
SNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIE
FLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagaccatggcgagcccagggaaagacaattatcgaatgaagagctataagaacaat
gctctaaaccctgaagaaatgagacgaagaagagaggaagagggcattcagctccggaag
cagaagcgagagcaacaactttttaaacggagaaatgtggagctgattaatgaagaagct
gccatgttcgatagtcttctcatggactcttatgtgagctctaccactggggagagtgtg
atcacaagagagatggtggagatgctcttttctgatgattctgacctgcagttagcaacc
acacagaaattccggaaactgctctccaaagagcctagtcctccaatagatgaagttatc
aacactccaagagtggtggatcggttcgtggagtttctgaagaggaatgagaattgtaca
ttacagtttgaagctgcctgggctctaacgaatattgcctctggaacctctcagcagacc
aaaattgtcattgaagcaggggctgtccccatttttatagagctgcttaattcagacttt
gaggatgttcaggaacaggcagtctgggcactgggaaacatagctggagatagctctgtt
tgccgagattacgtcttgaactgttccatccttaatcctttgttaacactccttaccaag
tccacacgactgacgatgacacggaatgcagtctgggccctgtcaaatctctgccgaggg
aaaaacccacccccagagtttgcaaaggtctctccttgtttgcctgtactgtctcgccta
ctcttcagcagcgactcggacttgctggcagatgcttgctgggccctttcttatctgtct
gatggccccaatgagaagatccaggcagtcatagactccggagtctgccggagattggta
gagctgctgatgcacaatgattacaaagtggcttctcctgccctgagagccgtgggtaac
atcgtcactggggatgacatccagacccaggtcattcttaactgttcagccctaccttgc
cttctccacttgttgagcagtcccaaggagtcaatccggaaggaagcttgctggactatt
tcaaatattactgctggcaacagggctcaaatacaggctgttatagatgcaaatatcttc
cctgtgttgatcgaaatccttcagaaagcagagtttcgtacaaggaaagaggcagcctgg
gccatcaccaatgccacatcaggaggaacccctgagcagatcaggtacctggtctcactg
ggctgcatcaaacccctatgtgacttgctgactgtaatggattcgaagattgtgcaagtg
gccctcaatggactggagaacatcctgcggcttggagagcaagagggcaagcgcagtggc
tcaggggtcaatccttattgtggcctcatagaggaagcctatggcttggataaaattgag
tttctccagagccacgagaaccaggagatctaccagaaggccttcgacctcattgagcac
tactttggtgtagaagacgatgatagcagcctggctccccaagtcgatgaaacgcaacag
cagttcatcttccagcagcctgaggcccccatggagggcttccagctataa

DBGET integrated database retrieval system