KEGG   Homo sapiens (human): 23635Help
Entry
23635             CDS       T01001                                 

Gene name
SSBP2, HSPC116, SOSS-B2
Definition
(RefSeq) single stranded DNA binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SSDP
Motif
Other DBs
NCBI-GeneID: 23635
NCBI-ProteinID: NP_036578
OMIM: 607389
HGNC: 15831
Ensembl: ENSG00000145687
Vega: OTTHUMG00000119039
Pharos: P81877(Tbio)
UniProt: P81877
Position
5q14.1
AA seq 361 aa AA seqDB search
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGF
LHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPP
GFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP
PRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNY
VGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGM
ESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMS
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaaaggcaagagtaacagcagcgccgtcccgtccgacagccaggcccgggag
aagttagcactctacgtatatgaatatctgctccatgtaggagctcagaaatcagctcaa
acatttttatcagagataagatgggaaaaaaacatcacattgggggaaccaccaggattc
ttacattcttggtggtgtgtattttgggatctctactgtgcagctccagagagacgtgaa
acatgtgaacactcaagtgaagcaaaagccttccatgattacagtgctgcagcagctccc
agtccagtgctaggaaacattcccccaggagatggcatgccagtaggtcctgtaccacca
gggttctttcagccttttatgtcacctcggtaccctggaggtccaaggcccccattgagg
atacctaatcaggcacttggaggtgtcccaggaagtcagccattactccccagtggaatg
gatccaactcgacaacaaggacatccaaatatgggtgggccaatgcagagaatgactcct
ccaagaggaatggtgcccttaggaccacagaactatggaggtgcaatgagacccccactg
aatgctttaggtggccctggaatgcctggaatgaacatgggtccaggtggtggtagacct
tggccaaacccaacaaatgccaattcaataccatactcctcagcatctcctgggaattat
gtaggtcctccaggaggtggagggccaccaggaacacccatcatgcctagtccagcagat
tcaaccaactctggtgataacatgtatactttaatgaatgcagtacctcctggacctaac
agacctaattttccaatgggtcctgggtcagatggtcccatgggtggattaggaggaatg
gagtcacatcacatgaatggctctttaggctcaggagatatggacagtatttccaagaat
tctcccaataatatgagcctgagtaatcaaccgggcactccaagggatgatggcgaaatg
gggggaaatttcttaaatccttttcagagtgagagttactcccctagcatgacaatgagc
gtgtga

DBGET integrated database retrieval system