KEGG   Homo sapiens (human): 23641Help
Entry
23641             CDS       T01001                                 

Gene name
LDOC1, BCUR1, Mar7, Mart7, RTL7, SIRH7
Definition
(RefSeq) LDOC1, regulator of NFKB signaling
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4939
Motif
Other DBs
NCBI-GeneID: 23641
NCBI-ProteinID: NP_036449
OMIM: 300402
HGNC: 6548
Ensembl: ENSG00000182195
Vega: OTTHUMG00000022558
Pharos: O95751(Tbio)
UniProt: O95751
Position
Xq27.1
AA seq 146 aa AA seqDB search
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGE
SSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRA
FLDEMKQCFGWDDDEDDDDEEEEDDY
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgagttggtgctgctgctgcacgcgctcctgatgcggcaccgcgccctgagc
atcgagaacagccagctcatggaacagctgcggctgctggtgtgcgagagggccagcctg
ctgcgccaggtacgtccgccgagctgcccggtgcccttccccgaaacgtttaatggcgag
agctcccggctccccgagtttatcgtgcagacggcgtcttacatgctcgtgaacgagaac
cgattctgcaacgacgccatgaaggtggcattcctaatcagcctcctcaccggggaagcc
gaggagtgggtggtgccctacatcgagatggatagccccatcctaggtgattaccgggcc
ttcctcgatgagatgaaacagtgctttggctgggatgacgacgaagacgacgacgacgaa
gaagaggaggatgattattag

DBGET integrated database retrieval system