KEGG   Homo sapiens (human): 23644Help
Entry
23644             CDS       T01001                                 

Gene name
EDC4, GE1, Ge-1, HEDL5, HEDLS, RCD-8, RCD8
Definition
(RefSeq) enhancer of mRNA decapping 4
  KO
K12616  enhancer of mRNA-decapping protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    23644 (EDC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23644 (EDC4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     23644 (EDC4)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     23644 (EDC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ge1_WD40 WD40 DUF445
Motif
Other DBs
NCBI-GeneID: 23644
NCBI-ProteinID: NP_055144
OMIM: 606030
HGNC: 17157
Ensembl: ENSG00000038358
Vega: OTTHUMG00000137543
Pharos: Q6P2E9(Tbio)
UniProt: Q6P2E9
Position
16q22.1
AA seq 1401 aa AA seqDB search
MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTS
ANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKI
QPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVA
DLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPF
IPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCL
SEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQ
DPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEY
LILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPA
EEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTA
HEDFTFGESRPELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMT
PSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPPEELTLSPKLQ
LDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTATSALSLELQEVEPLGLP
QASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASAASALHLLS
PRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCST
LAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVP
APRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRE
LAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQ
EQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGS
MKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDS
FRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEV
QHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLD
CQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLSQPVLLS
LIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNS
LGKAARRLSLMLHGLVTPSLP
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctgcgcgagcatcgacatcgaggacgccacgcagcacctgcgggacatcctc
aagctggaccggcccgcgggcggccccagtgcagagagcccacggccatccagtgcctac
aatggggacctcaatggacttctggtcccagacccgctctgctcaggtgatagtacctca
gcaaacaagactggtcttcggaccatgccacccattaacctgcaagagaagcaggtcatc
tgtctctcaggagatgatagctccacctgcattgggattttggccaaggaggtggagatt
gtggctagcagtgactctagcatttcaagcaaggcccggggaagcaacaaggtgaaaatt
cagcctgtcgccaagtatgactgggaacagaagtactactatggcaacctgattgctgtg
tctaactccttcttggcctatgccattcgggctgccaacaatggctctgccatggtgcgg
gtgatcagcgtcagcacttcggagcggaccttgctcaagggcttcacaggcagtgtggct
gatctggctttcgcgcacctcaactctccacagctggcctgcctggatgaggcaggcaac
ctgttcgtgtggcgcttggctctggttaatggcaaaattcaagaagagatcttggtccat
attcggcagccagagggcacgccactgaaccactttcgcaggatcatctggtgccccttc
atccctgaggagagcgaagactgctgtgaggagagcagcccaacagtggccctgctgcat
gaagaccgggctgaggtgtgggacctggacatgctccgctccagccacagtacctggcct
gtggatgttagccagatcaagcagggcttcattgtggtaaaaggtcatagcacgtgcctc
agtgaaggagccctctctcctgatgggactgtgctggctactgcgagccacgatggctat
gtcaagttctggcagatctacattgaggggcaagatgagccaaggtgtctgcacgagtgg
aaacctcatgatgggcggcccctctcctgcctcctgttctgtgacaaccataagaaacaa
gaccctgatgtccctttctggaggttccttattactggtgctgaccagaaccgagagtta
aagatgtggtgtacagtatcctggacctgcctgcagactattcgcttctccccagatatc
ttcagctcagtgagtgtgccccctagcctcaaggtttgcttggacctctcagcagaatac
ctgattctcagcgatgtgcaacggaaggtcctctatgtgatggagctgctgcaaaaccag
gaggagggccacgcctgcttcagctccatctcggagttcctgctcacccaccctgtgctg
agctttggtatccaggttgtgagtcgctgccggctacggcacactgaggtgctgcctgcc
gaagaggaaaatgacagcctgggtgctgatggtacccatggagccggtgccatggagtct
gcggccggtgtgctcatcaagctcttttgtgtgcatactaaggcactgcaagatgtgcag
atccgcttccagccacagctgaaccctgatgtggtggccccactgcccacccacactgcc
cacgaggacttcacatttggagagtctcggcccgaactgggctctgagggcctggggtca
gccgctcacggctcccagcctgacctccgacgaatcgtggagctgcctgcacctgccgac
ttcctcagtctgagcagtgagaccaagcccaagttgatgacacctgacgccttcatgaca
cctagcgcctccttgcagcagatcactgcctctcccagcagcagcagcagcggtagcagc
agcagcagcagcagtagcagcagctcccttacagctgtgtctgccatgagcagcacctca
gctgtggacccctccttgaccaggccacctgaggagctgaccttgagccccaagctgcag
ctggatggcagcctgacaatgagcagcagtggcagccttcaggcaagcccgcgtggcctc
ctgcctggcctgctcccagccccagctgacaaactgactcccaaggggccgggccaggtg
cctactgccacctctgcactgtccctggagctgcaggaagtggagcccctggggctaccc
caagcctcccctagccgcactcgttcccctgatgtcatctcctcagcttccactgccctg
tcccaggacatccctgagattgcatctgaggccctgtcccgtggttttggctcctctgca
ccagagggccttgagccagacagtatggcttcagccgcctcggcactgcacctgctgtcc
ccacggccccggccagggcccgagctcggcccccagctcgggcttgatggaggccctggg
gatggagatcggcataataccccctccctcctggaggcagccttgacccaggaggcctcg
actcctgacagtcaggtttggcccacagcacctgacattactcgtgagacctgcagcacc
ctggcagaaagccccaggaatggccttcaggaaaagcacaagagcctggccttccaccga
ccaccatatcacctgctgcagcaacgtgacagccaggatgccagtgctgagcaaagtgac
catgatgatgaggtggccagccttgcctctgcttcaggaggctttggcaccaaagttcct
gctccacggctgcctgccaaggactggaagaccaagggatcccctcgaacctcacccaag
ctcaagaggaaaagcaagaaggatgatggggatgcagccatgggatcccggctcacagag
caccaggtggcagagccccctgaggactggccagcactaatttggcaacagcagagagag
ctggcagagctgcggcacagccaggaagagctgctgcagcgtctgtgtacccaactcgaa
ggcctgcagagcacagtcacaggccacgtagaacgtgcccttgagactcggcacgagcag
gaacagcggcggctggagcgagcactggctgaggggcagcagcggggagggcagctgcag
gagcagctgacacaacagttgtcccaagcactgtcgtcagctgtagctgggcggctagag
cgcagcatacgggatgagatcaagaagacagtccctccatgtgtctcaaggagtctggag
cctatggcaggccaactgagcaactcagtggctaccaagctcacagctgtggagggcagc
atgaaagagaacatctccaagctgctcaagtccaagaacttgactgatgccatcgcccga
gcagctgcagacacattacaagggccgatgcaggctgcctaccgggaagccttccagagt
gtggtgctgccggcctttgagaagagctgccaggccatgttccagcaaatcaatgatagc
ttccggctggggacacaggaatacttgcagcagctagaaagccacatgaagagccggaag
gcacgggaacaggaggccagggagcctgtgctagcccagctgcggggcctggtcagcaca
ctgcagagtgccactgagcagatggcagccaccgtggccggcagtgttcgtgctgaggtg
cagcaccagctgcatgtggctgtgggcagcctgcaggagtccattttagcacaggtacag
cgcatcgttaagggtgaggtgagtgtggcgctcaaggagcagcaggccgccgtcacctcc
agcatcatgcaggccatgcgctcagctgctggcacacctgtcccctctgcccaccttgac
tgccaggcccagcaagcccatatcctgcagctgctgcagcagggccacctcaatcaggcc
ttccagcaggcgctgacagctgctgacctgaacctggtgctgtatgtgtgtgaaactgtg
gacccagcccaggtttttgggcagccaccctgcccgctctcccagcctgtgctcctttcc
ctcatccagcagctggcatctgaccttggcactcgaactgacctcaagctcagctacctg
gaagaggccgtgatgcacctggaccacagtgaccccatcactcgggaccacatgggctcc
gttatggcccaggtgcgccaaaagctttttcagttcctgcaggctgagccacacaactca
cttggcaaagcagctcggcgtctcagcctcatgctgcatggcctcgtgacccccagcctc
ccttag

DBGET integrated database retrieval system