KEGG   Homo sapiens (human): 23645
Entry
23645             CDS       T01001                                 

Symbol
PPP1R15A, GADD34
Name
(RefSeq) protein phosphatase 1 regulatory subunit 15A
  KO
K14019  protein phosphatase 1 regulatory subunit 15A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23645 (PPP1R15A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23645 (PPP1R15A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23645 (PPP1R15A)
SSDB
Motif
Pfam: PP1c_bdg
Other DBs
NCBI-GeneID: 23645
NCBI-ProteinID: NP_055145
OMIM: 611048
HGNC: 14375
Ensembl: ENSG00000087074
Vega: OTTHUMG00000183330
Pharos: O75807(Tbio)
UniProt: O75807
Structure
PDB: 
4XPN

Position
19q13.33
AA seq 674 aa
MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGL
EGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGE
REATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYP
PSHRECCPAVEEEDDEEAVKKEAHRTSTSALSPGSKPSTWVSCPGEEENQATEDKRTERS
KGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLK
SWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDE
DSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSA
STPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFR
GWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPET
PTHDPDPETPLKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQ
EELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLSQAVATPSRSS
AAAAAALDLSGRRG
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggccccaggccaagcaccccatcaggctaccccgtggagggatgcccaccctttcttc
ctcctgtccccagtgatgggcctcctcagccgcgcctggagccgcctgaggggcctggga
cctctagagccctggctggtggaagcagtaaaaggagcagctctggtagaagctggcctg
gagggagaagctaggactcctctggcaatcccccataccccttggggcagacgccctgaa
gaggaggctgaagacagtggaggccctggagaggacagagaaacactggggctgaaaacc
agcagttcccttcctgaagcctggggacttttggatgatgatgatggcatgtatggtgag
cgagaggcaaccagtgtccctagagggcagggaagtcaatttgcagatggccagcgtgct
cccctgtctcccagccttctgataaggacactgcaaggttctgataagaacccaggggag
gagaaagccgaggaagagggagttgctgaagaggagggagttaacaagttctcttatcca
ccatcacaccgggagtgttgtccagccgtggaggaggaggacgatgaagaagctgtaaag
aaagaagctcacagaacctctacttctgccttgtctccaggatccaagcccagcacttgg
gtgtcttgcccaggggaggaagagaatcaagccacggaggataaaagaacagaaagaagt
aaaggagccaggaagacctccgtgtccccccgatcttcaggctccgaccccaggtcctgg
gagtatcgttcaggagaggcgtccgaggagaaggaggaaaaggcacacaaagaaactggg
aaaggagaagctgccccagggccgcaatcctcagccccagcccagaggccccagctcaag
tcctggtggtgccaacccagtgatgaagaggagggtgaggtcaaggctttgggggcagct
gagaaggatggagaagctgagtgtcctccctgcatccccccaccaagtgccttcctgaag
gcctgggtgtattggccaggagaggacacagaggaagaggaagatgaggaagaagatgag
gacagtgactctggatcagatgaggaagagggagaagctgaggcttcctcttccactcct
gctacaggtgtcttcttgaagtcctgggtctatcagccaggagaggacacagaggaggag
gaagatgaggacagtgatacaggatcagccgaggatgaaagagaagctgagacttctgct
tccacaccccctgcaagtgctttcttgaaggcctgggtgtatcggccaggagaggacacg
gaggaggaggaagatgaggatgtggatagtgaggataaggaagatgattcagaagcagcc
ttgggagaagctgagtcagacccacatccctcccacccggaccagagggcccacttcagg
ggctggggatatcgacctggaaaagagacagaggaagaggaagctgctgaggactgggga
gaagctgagccctgccccttccgagtggccatctatgtacctggagagaagccaccgcct
ccctgggctcctcctaggctgcccctccgactgcaaaggcggctcaagcgcccagaaacc
cctactcatgatccggaccctgagactcccctaaaggccagaaaggtgcgcttctccgag
aaggtcactgtccatttcctggctgtctgggcagggccggcccaggccgcccgccagggc
ccctgggagcagcttgctcgggatcgcagccgcttcgcacgccgcatcacccaggcccag
gaggagctgagcccctgcctcacccctgctgcccgggccagagcctgggcacgcctcagg
aacccacctttagcccccatccctgccctcacccagaccttgccttcctcctctgtccct
tcgtccccagtccagaccacgcccttgagccaagctgtggccacaccttcccgctcgtct
gctgctgcagcggctgccctggacctcagtgggaggcgtggctga

DBGET integrated database retrieval system