KEGG   Homo sapiens (human): 23647Help
Entry
23647             CDS       T01001                                 

Gene name
ARFIP2, POR1
Definition
(RefSeq) ADP ribosylation factor interacting protein 2
  KO
K20314  arfaptin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23647 (ARFIP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   Others
    23647 (ARFIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arfaptin BAR BAR_3
Motif
Other DBs
NCBI-GeneID: 23647
NCBI-ProteinID: NP_036534
OMIM: 601638
HGNC: 17160
Ensembl: ENSG00000132254
Vega: OTTHUMG00000133406
Pharos: P53365(Tbio)
UniProt: P53365 B4DXH2
Structure
PDB: 

Position
11p15.4
AA seq 341 aa AA seqDB search
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgggatcctagggaaggcagccacaatggagatccctatccacgggaacggc
gaagccaggcagcttcctgaagatgatgggctggagcaggacctccagcaggtgatggtg
tcaggacccaacctcaatgaaaccagcattgtgtctggtggctatgggggctctggtgat
ggactcatccccacagggtctggccgccatccatctcacagcaccactccttctggccct
ggagatgaggtggctcggggcattgctggagaaaagtttgacatcgtcaagaaatggggc
atcaacacctataagtgcacaaagcaactgttatcagaacgatttggtcgaggctcacgg
actgtggacctggagctagagctgcagattgagttgctgcgtgagacgaagcgcaagtat
gagagtgtcctgcagctgggccgggcactgacagcccacctctacagcctgctgcagacc
cagcatgcactgggtgatgcctttgctgacctcagccagaagtccccagagcttcaggag
gaatttggctacaatgcagagacacagaaactactatgcaagaatggggaaacgctgcta
ggagccgtgaacttctttgtctctagcatcaacacattggtcaccaagaccatggaagac
acgctcatgactgtgaaacagtatgaggctgccaggctggaatatgatgcctaccgaaca
gacttagaggagctgagtctaggcccccgggatgcagggacacgtggtcgacttgagagt
gcccaggccactttccaggcccatcgggacaagtatgagaagctgcggggagatgtggcc
atcaagctcaagttcctggaagaaaacaagatcaaggtgatgcacaagcagctgctgctc
ttccacaatgctgtgtccgcctactttgctgggaaccagaaacagctggagcagaccctg
cagcagttcaacatcaagctgcggcctccaggagctgagaaaccctcctggctagaggag
cagtga

DBGET integrated database retrieval system