KEGG   Homo sapiens (human): 23650Help
Entry
23650             CDS       T01001                                 

Gene name
TRIM29, ATDC
Definition
(RefSeq) tripartite motif containing 29
  KO
K12010  tripartite motif-containing protein 29
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23650 (TRIM29)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    23650 (TRIM29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-B_box MIS13 PSP1
Motif
Other DBs
NCBI-GeneID: 23650
NCBI-ProteinID: NP_036233
OMIM: 610658
HGNC: 17274
Ensembl: ENSG00000137699
Vega: OTTHUMG00000140377
Pharos: Q14134(Tbio)
UniProt: Q14134 A0A024R3J1
Structure
PDB: 

Position
11q23.3
AA seq 588 aa AA seqDB search
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
VRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcagatgcctccaggagcaacgggtcgagcccagaagccagggatgcccgg
agcccgtcgggccccagtggcagcctggagaatggcaccaaggctgacggcaaggatgcc
aagaccaccaacgggcacggcggggaggcagctgagggcaagagcctgggcagcgccctg
aagccaggggaaggtaggagcgccctgttcgcgggcaatgagtggcggcgacccatcatc
cagtttgtcgagtccggggacgacaagaactccaactacttcagcatggactctatggaa
ggcaagaggtcgccgtacgcagggctccagctgggggctgccaagaagccacccgttacc
tttgccgaaaagggcgagctgcgcaagtccattttctcggagtcccggaagcccacggtg
tccatcatggagcccggggagacccggcggaacagctacccccgggccgacacgggcctt
ttttcacggtccaagtccggctccgaggaggtgctgtgcgactcctgcatcggcaacaag
cagaaggcggtcaagtcctgcctggtgtgccaggcctccttctgcgagctgcatctcaag
ccccacctggagggcgccgccttccgagaccaccagctgctcgagcccatccgggacttt
gaggcccgcaagtgtcccgtgcatggcaagacgatggagctcttctgccagaccgaccag
acctgcatctgctacctttgcatgttccaggagcacaagaatcatagcaccgtgacagtg
gaggaggccaaggccgagaaggagacggagctgtcattgcaaaaggagcagctgcagctc
aagatcattgagattgaggatgaagctgagaagtggcagaaggagaaggaccgcatcaag
agcttcaccaccaatgagaaggccatcctggagcagaacttccgggacctggtgcgggac
ctggagaagcaaaaggaggaagtgagggctgcgctggagcagcgggagcaggatgctgtg
gaccaagtgaaggtgatcatggatgctctggatgagagagccaaggtgctgcatgaggac
aagcagacccgggagcagctgcatagcatcagcgactctgtgttgtttctgcaggaattt
ggtgcattgatgagcaattactctctccccccacccctgcccacctatcatgtcctgctg
gagggggagggcctgggacagtcactaggcaacttcaaggacgacctgctcaatgtatgc
atgcgccacgttgagaagatgtgcaaggcggacctgagccgtaacttcattgagaggaac
cacatggagaacggtggtgaccatcgctatgtgaacaactacacgaacagcttcgggggt
gagtggagtgcaccggacaccatgaagagatactccatgtacctgacacccaaaggtggg
gtccggacatcataccagccctcgtctcctggccgcttcaccaaggagaccacccagaag
aatttcaacaatctctatggcaccaaaggtaactacacctcccgggtctgggagtactcc
tccagcattcagaactctgacaatgacctgcccgtcgtccaaggcagctcctccttctcc
ctgaaaggctatccctccctcatgcggagccaaagccccaaggcccagccccagacttgg
aaatctggcaagcagactatgctgtctcactaccggccattctacgtcaacaaaggcaac
gggattgggtccaacgaagccccatga

DBGET integrated database retrieval system