KEGG   Homo sapiens (human): 23676Help
Entry
23676             CDS       T01001                                 

Gene name
SMPX, Chisel, Csl, DFN6, DFNX4
Definition
(RefSeq) small muscle protein X-linked
Organism
hsa  Homo sapiens (human)
Disease
H01209  Deafness, X-linked
SSDB OrthologParalogGFIT
Motif
Pfam: Chisel
Motif
Other DBs
NCBI-GeneID: 23676
NCBI-ProteinID: NP_055147
OMIM: 300066 300226
HGNC: 11122
Ensembl: ENSG00000091482
Vega: OTTHUMG00000021235
Pharos: Q9UHP9(Tbio)
UniProt: Q9UHP9 A0A024RBY1
Position
Xp22.12
AA seq 88 aa AA seqDB search
MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA
KKLPGPAVNLSEIQNIKSELKYVPKAEQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcgaaacagccagtttccaatgttagagccatccaggcaaatatcaatatt
ccaatgggagcctttcggccaggagcaggtcaaccccccagaagaaaagaatgtactcct
gaagtggaggagggtgttcctcccacctcggatgaggagaagaagccaattccaggagcg
aagaaacttccaggacctgcagtcaatctatcggaaatccagaatattaaaagtgaacta
aaatatgtccccaaagctgaacagtag

DBGET integrated database retrieval system