KEGG   Homo sapiens (human): 23683
Entry
23683             CDS       T01001                                 

Gene name
PRKD3, EPK2, PKC-NU, PKD3, PRKCN, nPKC-NU
Definition
(RefSeq) protein kinase D3
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    23683 (PRKD3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    23683 (PRKD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23683 (PRKD3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     23683 (PRKD3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   23683 (PRKD3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9 RIO1 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 23683
NCBI-ProteinID: NP_005804
OMIM: 607077
HGNC: 9408
Ensembl: ENSG00000115825
Vega: OTTHUMG00000100961
Pharos: O94806(Tchem)
UniProt: O94806
Structure
PDB: 
2D9Z

Position
2p22.2
AA seq 890 aa
MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgtctgcaaataattcccctccatcagcccagaagtctgtattacccacagctattcct
gctgtgcttccagctgcttctccgtgttcaagtcctaagacgggactctctgcccgactc
tctaatggaagcttcagtgcaccatcactcaccaactccagaggctcagtgcatacagtt
tcatttctactgcaaattggcctcacacgggagagtgttaccattgaagcccaggaactg
tctttatctgctgtcaaggatcttgtgtgctccatagtttatcaaaagtttccagagtgt
ggattctttggcatgtatgacaaaattcttctctttcgccatgacatgaactcagaaaac
attttgcagctgattacctcagcagatgaaatacatgaaggagacctagtggaagtggtt
ctttcagctttagccacagtagaagacttccagattcgtccacatactctctatgtacat
tcttacaaagctcctactttctgtgattactgtggtgagatgctctggggattggtacgt
caaggactgaaatgtgaaggctgtggattaaattaccataaacgatgtgccttcaagatt
ccaaataactgtagtggagtaagaaagagacgtctgtcaaatgtatctttaccaggaccc
ggcctctcagttccaagacccctacagcctgaatatgtagcccttcccagtgaagagtca
catgtccaccaggaaccaagtaagagaattccttcttggagtggtcgcccaatctggatg
gaaaagatggtaatgtgcagagtgaaagttccacacacatttgctgttcactcttacacc
cgtcccacgatatgtcagtactgcaagcggttactgaaaggcctctttcgccaaggaatg
cagtgtaaagattgcaaattcaactgccataaacgctgtgcatcaaaagtaccaagagac
tgccttggagaggttactttcaatggagaaccttccagtctgggaacagatacagatata
ccaatggatattgacaataatgacataaatagtgatagtagtcggggtttggatgacaca
gaagagccatcacccccagaagataagatgttcttcttggatccatctgatctcgatgtg
gaaagagatgaagaagccgttaaaacaatcagtccatcaacaagcaataatattccgcta
atgagggttgtacaatccatcaagcacacaaagaggaagagcagcacaatggtgaaggaa
gggtggatggtccattacaccagcagggataacctgagaaagaggcattattggagactt
gacagcaaatgtctaacattatttcagaatgaatctggatcaaagtattataaggaaatt
ccactttcagaaattctccgcatatcttcaccacgagatttcacaaacatttcacaaggc
agcaatccacactgttttgaaatcattactgatactatggtatacttcgttggtgagaac
aatggggacagctctcataatcctgttcttgctgccactggagttggacttgatgtagca
cagagctgggaaaaagcaattcgccaagccctcatgcctgttactcctcaagcaagtgtt
tgcacttctccagggcaagggaaagatcacaaagatttgtctacaagtatctctgtatct
aattgtcagattcaggagaatgtggatatcagtactgtttaccagatctttgcagatgag
gtgcttggttcaggccagtttggcatcgtttatggaggaaaacatagaaagactgggagg
gatgtggctattaaagtaattgataagatgagattccccacaaaacaagaaagtcaactc
cgtaatgaagtggctattttacagaatttgcaccatcctgggattgtaaacctggaatgt
atgtttgaaaccccagaacgagtctttgtagtaatggaaaagctgcatggagatatgttg
gaaatgattctatccagtgagaaaagtcggcttccagaacgaattactaaattcatggtc
acacagatacttgttgctttgaggaatctgcattttaagaatattgtgcactgtgattta
aagccagaaaatgtgctgcttgcatcagcagagccatttcctcaggtgaagctgtgtgac
tttggatttgcacgcatcattggtgaaaagtcattcaggagatctgtggtaggaactcca
gcatacttagcccctgaagttctccggagcaaaggttacaaccgttccctagatatgtgg
tcagtgggagttatcatctatgtgagcctcagtggcacatttccttttaatgaggatgaa
gatataaatgaccaaatccaaaatgctgcatttatgtacccaccaaatccatggagagaa
atttctggtgaagcaattgatctgataaacaatctgcttcaagtgaagatgagaaaacgt
tacagtgttgacaaatctcttagtcatccctggctacaggactatcagacttggcttgac
cttagagaatttgaaactcgcattggagaacgttacattacacatgaaagtgatgatgct
cgctgggaaatacatgcatacacacataaccttgtatacccaaagcacttcattatggct
cctaatccagatgatatggaagaagatccttaa

DBGET integrated database retrieval system