KEGG   Homo sapiens (human): 23704
Entry
23704             CDS       T01001                                 

Gene name
KCNE4, MIRP3
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 4
  KO
K04898  potassium voltage-gated channel Isk-related subfamily E member 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    23704 (KCNE4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   23704 (KCNE4)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 23704
NCBI-ProteinID: NP_542402
OMIM: 607775
HGNC: 6244
Vega: OTTHUMG00000133161
Pharos: Q8WWG9(Tbio)
UniProt: Q8WWG9 A5H1P5
Position
2q36.1
AA seq 170 aa
MLKMEPLNSTHPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKS
KRREKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSM
EGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgctgaaaatggagcctctgaacagcacgcaccccggcaccgccgcctccagcagcccc
ctggagtcccgtgcggccggcggcggcagcggcaatggcaacgagtacttctacattctg
gttgtcatgtccttctacggcattttcttgatcggaatcatgctgggctacatgaaatcc
aagaggcgggagaagaagtccagcctcctgctgctgtacaaagacgaggagcggctctgg
ggggaggccatgaagccgctgcctgtggtgtcgggcctgaggtcggtgcaggtgcccctg
atgctgaacatgctgcaggagagcgtggcgcccgcgctgtcctgcaccctctgttccatg
gaaggggacagcgtgagctccgagtcctcctccccggacgtgcacctcaccattcaggag
gagggggcagacgatgagctggaggagacctcggagacgcccctcaacgagagcagcgaa
gggtcctcggagaacatccatcagaattcctag

DBGET integrated database retrieval system