KEGG   Homo sapiens (human): 23705Help
Entry
23705             CDS       T01001                                 

Gene name
CADM1, BL2, IGSF4, IGSF4A, NECL2, Necl-2, RA175, ST17, SYNCAM, TSLC1, sTSLC-1, sgIGSF, synCAM1
Definition
(RefSeq) cell adhesion molecule 1
  KO
K06781  cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00054  Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23705 (CADM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    23705 (CADM1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Necl family
   23705 (CADM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 Izumo-Ig Ig_4 Ig_C17orf99 C1-set Syndecan DUF3439
Motif
Other DBs
NCBI-GeneID: 23705
NCBI-ProteinID: NP_055148
OMIM: 605686
HGNC: 5951
Ensembl: ENSG00000182985
Vega: OTTHUMG00000168202
Pharos: Q9BY67(Tbio)
UniProt: Q9BY67 X5D8W0
Structure
PDB: 

Position
11q23.3
AA seq 442 aa AA seqDB search
MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVA
TISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEG
RYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWF
KGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ
YKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITD
SRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA
DTAIINAEGGQNNSEEKKEYFI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtagtgctgccgagcggatcccagtgtgcggcggcagcggcggcggcggcg
cctcccgggctccggctccggcttctgctgttgctcttctccgccgcggcactgatcccc
acaggtgatgggcagaatctgtttacgaaagacgtgacagtgatcgagggagaggttgcg
accatcagttgccaagtcaataagagtgacgactctgtgattcagctactgaatcccaac
aggcagaccatttatttcagggacttcaggcctttgaaggacagcaggtttcagttgctg
aatttttctagcagtgaactcaaagtatcattgacaaacgtctcaatttctgatgaagga
agatacttttgccagctctataccgatcccccacaggaaagttacaccaccatcacagtc
ctggtcccaccacgtaatctgatgatcgatatccagaaagacactgcggtggaaggtgag
gagattgaagtcaactgcactgctatggccagcaagccagccacgactatcaggtggttc
aaagggaacacagagctaaaaggcaaatcggaggtggaagagtggtcagacatgtacact
gtgaccagtcagctgatgctgaaggtgcacaaggaggacgatggggtcccagtgatctgc
caggtggagcaccctgcggtcactggaaacctgcagacccagcggtatctagaagtacag
tataagcctcaagtgcacattcagatgacttatcctctacaaggcttaacccgggaaggg
gacgcgcttgagttaacatgtgaagccatcgggaagccccagcctgtgatggtaacttgg
gtgagagtcgatgatgaaatgcctcaacacgccgtactgtctgggcccaacctgttcatc
aataacctaaacaaaacagataatggtacataccgctgtgaagcttcaaacatagtgggg
aaagctcactcggattatatgctgtatgtatacgatccccccacaactatccctcctccc
acaacaaccaccaccaccaccaccaccaccaccaccaccatccttaccatcatcacagat
tcccgagcaggtgaagaaggctcgatcagggcagtggatcatgccgtgatcggtggcgtc
gtggcggtggtggtgttcgccatgctgtgcttgctcatcattctggggcgctattttgcc
agacataaaggtacatacttcactcatgaagccaaaggagccgatgacgcagcagacgca
gacacagctataatcaatgcagaaggaggacagaacaactccgaagaaaagaaagagtac
ttcatctag

DBGET integrated database retrieval system