KEGG   Homo sapiens (human): 23729
Entry
23729             CDS       T01001                                 

Gene name
SHPK, CARKL, SHK
Definition
(RefSeq) sedoheptulokinase
  KO
K11214  sedoheptulokinase [EC:2.7.1.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.14  sedoheptulokinase
     23729 (SHPK)
SSDB
Motif
Pfam: FGGY_N DUF5593 BcrAD_BadFG
Other DBs
NCBI-GeneID: 23729
NCBI-ProteinID: NP_037408
OMIM: 605060
HGNC: 1492
Ensembl: ENSG00000197417
Vega: OTTHUMG00000090694
Pharos: Q9UHJ6(Tbio)
UniProt: Q9UHJ6 A0A0B4J2A0
Position
17p13.2
AA seq 478 aa
MAARPITLGIDLGTTSVKAALLRAAPDDPSGFAVLASCARAARAEAAVESAVAGPQGREQ
DVSRILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRA
VSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHD
YVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRT
SHMWFEIPKGTQVGVALGDLQASVYSCMAQRTDAVLNISTSVQLAASMPSGFQPAQTPDP
TAPVAYFPYFNRTYLGVAASLNGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAVQ
QRDTHLTITPTVLGERHLPDQLASVTRISSSDLSLGHVTRALCRGIVQNLHSMLPIQQLQ
EWGVERVMGSGSALSRNDVLKQEVQRAFPLPMSFGQDVDAAVGAALVMLRRHLNQKES
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggctgcgcggccgatcaccctcggcattgacctgggcaccacatctgtgaaggcagct
ctgctgagggccgcgcccgacgacccatccgggttcgcagtgctggcgagctgtgcccgt
gctgcgcgggcagaggcggcggtcgagagcgcggtggccgggccccaggggcgggagcag
gatgtgagtagaatcctccaagccctacacgagtgccttgctgcccttccccgaccccag
ctccggagcgtcgtgggcatcggggtgtcgggccagatgcatggagtcgtgttttggaaa
acaggccaaggctgtgaatggacagagggagggattaccccggtgttcgagccccgagct
gttagccacctggtcacgtggcaggatggccgatgtagcagcgaattcctggcctctctg
ccccagccgaagtctcatctcagtgtggccacgggcttcggctgtgcaaccatcttctgg
cttttgaaatatcgcccagagttcctgaagtcctacgacgcagccggtaccatccacgac
tatgtggttgccatgctgtgtggcttgccaagacctctgatgtccgaccagaatgctgcc
agctggggctatttcaacacgcagagccaaagctggaacgtagagacactgaggagctcg
ggttttcctgtccacctgctcccagacatcgccgagcctggcagtgtggcgggcagaact
tcccacatgtggtttgaaatcccaaaggggacgcaggtgggagtggccttgggtgattta
caggcctctgtctattcctgcatggcccagaggacagatgcagttctcaacatcagcacc
tcggttcagctggcagcctccatgccttcaggattccagcctgcacagactccagaccct
acggccccagtcgcctacttcccatacttcaacaggacctacctgggggtggccgcgtca
ctcaacgggggcaatgtgctggccacgttcgtccacatgctggttcagtggatggcagat
ctaggcctggaggttgaagaatccactgtgtattcacgcatgattcaggcagctgtgcag
cagagagatacccacctgaccatcaccccgacagtgctgggggagaggcacctgccggac
cagctggcctcagtgaccagaatctcctcctccgacctctccctggggcacgtgacccgg
gctctgtgccgaggcattgttcagaacctgcactccatgcttccgattcagcagctccag
gagtggggcgtggagagggtgatgggcagtgggagtgcgctgtccaggaatgacgtgctg
aagcaggaggtgcagagggctttccctttgcccatgtcctttgggcaggatgtggatgca
gctgtcggggcagctctggtcatgctccggagacacctcaaccagaaggaatcttag

DBGET integrated database retrieval system