KEGG   Homo sapiens (human): 23753Help
Entry
23753             CDS       T01001                                 

Gene name
SDF2L1
Definition
(RefSeq) stromal cell derived factor 2 like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MIR
Motif
Other DBs
NCBI-GeneID: 23753
NCBI-ProteinID: NP_071327
OMIM: 607551
HGNC: 10676
Ensembl: ENSG00000128228
Vega: OTTHUMG00000150820
Pharos: Q9HCN8(Tdark)
UniProt: Q9HCN8
Position
22q11.21
AA seq 221 aa AA seqDB search
MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKY
GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHF
PSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGS
PIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEPSAGHDEL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcgcgggccgcggcggggctgcctggccggtgctgttggggctgctgctggcg
ctgttagtgccgggcggtggtgccgccaagaccggtgcggagctcgtgacctgcgggtcg
gtgctgaagctgctcaatacgcaccaccgcgtgcggctgcactcgcacgacatcaaatac
ggatccggcagcggccagcaatcggtgaccggcgtagaggcgtcggacgacgccaatagc
tactggcggatccgcggcggctcggagggcgggtgcccgcgcgggtccccggtgcgctgc
gggcaggcggtgaggctcacgcatgtgcttacgggcaagaacctgcacacgcaccacttc
ccgtcgccgctgtccaacaaccaggaggtgagtgcctttggggaagacggcgagggcgac
gacctggacctatggacagtgcgctgctctggacagcactgggagcgtgaggctgctgtg
cgcttccagcatgtgggcacctctgtgttcctgtcagtcacgggtgagcagtatggaagc
cccatccgtgggcagcatgaggtccacggcatgcccagtgccaacacgcacaatacgtgg
aaggccatggaaggcatcttcatcaagcctagtgtggagccctctgcaggtcacgatgaa
ctctga

DBGET integrated database retrieval system