KEGG   Homo sapiens (human): 23761Help
Entry
23761             CDS       T01001                                 

Gene name
PISD, DJ858B16, PSD, PSDC, PSSC, dJ858B16.2
Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    23761 (PISD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     23761 (PISD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 23761
NCBI-ProteinID: NP_001313340
OMIM: 612770
HGNC: 8999
Ensembl: ENSG00000241878
Vega: OTTHUMG00000030252
Pharos: Q9UG56(Tbio)
UniProt: Q9UG56
Position
22q12.2
AA seq 409 aa AA seqDB search
MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPART
MFLLRPLPILLVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLS
RAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV
CGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCTEDLPFPPAASCDSFK
NQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC
HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR
EGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtccgtggggcaccgatgtctgggattactgcacggggtcgcgccgtggcgg
agcagcctccatccctgtgagatcactgccctgagccaatccctacagcccttacggaag
ctgccttttagagcctttcgcacagatgccagaaaaatccacactgcccctgcccgaacc
atgttcctgctgcgtcccctgcccattctgttggtgacaggcggcgggtatgcagggtac
cggcagtatgagaagtacagggagcgagagctggagaagctgggattggagattccaccc
aaacttgctggtcactgggaggtggctttgtacaagtcagtgccaacgcgcttgctgtca
cgggcctggggtcgcctcaatcaggtggagctgccacactggctgcgcaggcccgtctac
agcctgtacatctggacgtttggggtgaacatgaaagaggccgctgtggaggacctgcat
cactaccgcaacctcagcgagttcttccggcgcaagctgaagccgcaggcccggcctgtc
tgtggcctgcacagcgtgattagcccatcggatggaaggatcctcaactttgggcaggtg
aagaactgtgaggtggagcaggtaaagggggtcacctactccctggagtcgttcctgggc
ccgcgtatgtgcacagaggacctgcccttcccaccagccgcgtcgtgtgactccttcaag
aaccagctggtcacccgggaagggaatgagctctatcactgtgtcatctacctggcccct
ggggactaccactgcttccactcccccaccgactggactgtgtcccaccggcgccacttc
ccaggctccctgatgtcagtgaaccctggcatggctcgctggatcaaagagctcttctgc
cataacgagcgggtggtcctgacgggggactggaaacatggcttcttctcactgacagct
gtgggggccaccaacgtgggctccattcgcatctactttgaccgggacctgcacacaaac
agcccaaggcacagcaagggctcctacaatgacttcagcttcgtgacgcacaccaataga
gagggcgtccccatgcgtaagggcgagcacctgggcgagttcaacctgggctccaccatc
gtgctcatcttcgaggcccccaaggacttcaatttccagctgaaaacaggacagaaaatc
cgctttggggaagccctgggctcgctctag

DBGET integrated database retrieval system