KEGG   Homo sapiens (human): 23764
Entry
23764             CDS       T01001                                 

Gene name
MAFF, U-MAF, hMafF
Definition
(RefSeq) MAF bZIP transcription factor F
  KO
K09037  transcription factor MAFF/G/K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    23764 (MAFF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    23764 (MAFF)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 DUF2046 DivIC bZIP_2 DUF2353 CCDC85 PKK Nup54 DUF1192 Macoilin Spc7 SlyX YabA
Other DBs
NCBI-GeneID: 23764
NCBI-ProteinID: NP_001155044
OMIM: 604877
HGNC: 6780
Ensembl: ENSG00000185022
Vega: OTTHUMG00000151163
Pharos: Q9ULX9(Tbio)
UniProt: Q9ULX9
Position
22q13.1
AA seq 164 aa
MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS
VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtctgtggatcccctatccagcaaagctctaaagatcaagcgagagctgagcgagaac
acgccgcacctgtcggacgaggcgctgatggggctgtcggtgcgcgagctgaaccggcat
ctgcgcgggctctccgccgaggaggtgacacggctcaagcagcggcgccgcacactcaaa
aaccgtggctacgccgccagctgccgcgtgaagcgcgtgtgccagaaggaggagctgcag
aagcagaagtcggagctggagcgcgaggtggacaagctggcgcgcgagaacgccgccatg
cgcctggagctcgacgcgctgcgcggcaagtgcgaggcgctgcagggcttcgcgcgctcc
gtggccgccgcccgcgggcccgccacgctcgtggcgccggccagcgtcatcaccatcgtc
aagtccaccccgggctcggggtctggccccgcccacggcccggaccccgcccacggcccg
gcctcctgctcctag

DBGET integrated database retrieval system