KEGG   Homo sapiens (human): 23765Help
Entry
23765             CDS       T01001                                 

Gene name
IL17RA, CANDF5, CD217, CDw217, IL-17RA, IL17R, IMD51, hIL-17R
Definition
(RefSeq) interleukin 17 receptor A
  KO
K05164  interleukin 17 receptor A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Disease
H00363  Candidiasis
H01109  Chronic mucocutaneous candidiasis
Drug target
Brodalumab: D10061
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23765 (IL17RA)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    23765 (IL17RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    23765 (IL17RA)
   04090 CD molecules [BR:hsa04090]
    23765 (IL17RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL17 receptor family
   23765 (IL17RA)
CD molecules [BR:hsa04090]
 Proteins
  23765 (IL17RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL17R_fnIII_D1 IL17R_fnIII_D2 SEFIR
Motif
Other DBs
NCBI-GeneID: 23765
NCBI-ProteinID: NP_055154
OMIM: 605461
HGNC: 5985
Ensembl: ENSG00000177663
Vega: OTTHUMG00000150026
Pharos: Q96F46(Tclin)
UniProt: Q96F46
Structure
PDB: 

Position
22q11.1
AA seq 866 aa AA seqDB search
MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDD
SWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLN
TNERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNF
LVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHM
ENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTK
YTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFT
AAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLE
MFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQP
APQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLP
VDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHT
PYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ
RQLLFRQLQKNSGWDTMGSESEGPSA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcacgcagcccgccgtccgctgtcccggggcccctgctggggctgctcctg
ctgctcctgggcgtgctggccccgggtggcgcctccctgcgactcctggaccaccgggcg
ctggtctgctcccagccggggctaaactgcacggtcaagaatagtacctgcctggatgac
agctggattcaccctcgaaacctgaccccctcctccccaaaggacctgcagatccagctg
cactttgcccacacccaacaaggagacctgttccccgtggctcacatcgaatggacactg
cagacagacgccagcatcctgtacctcgagggtgcagagttatctgtcctgcagctgaac
accaatgaacgtttgtgcgtcaggtttgagtttctgtccaaactgaggcatcaccacagg
cggtggcgttttaccttcagccactttgtggttgaccctgaccaggaatatgaggtgacc
gttcaccacctgcccaagcccatccctgatggggacccaaaccaccagtccaagaatttc
cttgtgcctgactgtgagcacgccaggatgaaggtaaccacgccatgcatgagctcaggc
agcctgtgggaccccaacatcaccgtggagaccctggaggcccaccagctgcgtgtgagc
ttcaccctgtggaacgaatctacccattaccagatcctgctgaccagttttccgcacatg
gagaaccacagttgctttgagcacatgcaccacatacctgcgcccagaccagaagagttc
caccagcgatccaacgtcacactcactctacgcaaccttaaagggtgctgtcgccaccaa
gtgcagatccagcccttcttcagcagctgcctcaatgactgcctcagacactccgcgact
gtttcctgcccagaaatgccagacactccagaaccaattccggactacatgcccctgtgg
gtgtactggttcatcacgggcatctccatcctgctggtgggctccgtcatcctgctcatc
gtctgcatgacctggaggctagctgggcctggaagtgaaaaatacagtgatgacaccaaa
tacaccgatggcctgcctgcggctgacctgatccccccaccgctgaagcccaggaaggtc
tggatcatctactcagccgaccaccccctctacgtggacgtggtcctgaaattcgcccag
ttcctgctcaccgcctgcggcacggaagtggccctggacctgctggaagagcaggccatc
tcggaggcaggagtcatgacctgggtgggccgtcagaagcaggagatggtggagagcaac
tctaagatcatcgtcctgtgctcccgcggcacgcgcgccaagtggcaggcgctcctgggc
cggggggcgcctgtgcggctgcgctgcgaccacggaaagcccgtgggggacctgttcact
gcagccatgaacatgatcctcccggacttcaagaggccagcctgcttcggcacctacgta
gtctgctacttcagcgaggtcagctgtgacggcgacgtccccgacctgttcggcgcggcg
ccgcggtacccgctcatggacaggttcgaggaggtgtacttccgcatccaggacctggag
atgttccagccgggccgcatgcaccgcgtaggggagctgtcgggggacaactacctgcgg
agcccgggcggcaggcagctccgcgccgccctggacaggttccgggactggcaggtccgc
tgtcccgactggttcgaatgtgagaacctctactcagcagatgaccaggatgccccgtcc
ctggacgaagaggtgtttgaggagccactgctgcctccgggaaccggcatcgtgaagcgg
gcgcccctggtgcgcgagcctggctcccaggcctgcctggccatagacccgctggtcggg
gaggaaggaggagcagcagtggcaaagctggaacctcacctgcagccccggggtcagcca
gcgccgcagcccctccacaccctggtgctcgccgcagaggagggggccctggtggccgcg
gtggagcctgggcccctggctgacggtgccgcagtccggctggcactggcgggggagggc
gaggcctgcccgctgctgggcagcccgggcgctgggcgaaatagcgtcctcttcctcccc
gtggaccccgaggactcgccccttggcagcagcacccccatggcgtctcctgacctcctt
ccagaggacgtgagggagcacctcgaaggcttgatgctctcgctcttcgagcagagtctg
agctgccaggcccaggggggctgcagtagacccgccatggtcctcacagacccacacacg
ccctacgaggaggagcagcggcagtcagtgcagtctgaccagggctacatctccaggagc
tccccgcagccccccgagggactcacggaaatggaggaagaggaggaagaggagcaggac
ccagggaagccggccctgccactctctcccgaggacctggagagcctgaggagcctccag
cggcagctgcttttccgccagctgcagaagaactcgggctgggacacgatggggtcagag
tcagaggggcccagtgcatga

DBGET integrated database retrieval system