KEGG   Homo sapiens (human): 23770Help
Entry
23770             CDS       T01001                                 

Gene name
FKBP8, FKBP38, FKBPr38
Definition
(RefSeq) FKBP prolyl isomerase 8
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23770 (FKBP8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    23770 (FKBP8)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     23770 (FKBP8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     23770 (FKBP8)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    23770 (FKBP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_14 Fis1_TPR_C TPR_16 TPR_9 TPR_11 TPR_8 TPR_7 TPR_19 TPR_12 ANAPC3 TPR_17 TPR_6 TPR_20 NARP1
Motif
Other DBs
NCBI-GeneID: 23770
NCBI-ProteinID: NP_001295302
OMIM: 604840
HGNC: 3724
Ensembl: ENSG00000105701
Vega: OTTHUMG00000183368
Pharos: Q14318(Tbio)
UniProt: Q14318 A0A024R7P2 B2R8G6
Structure
PDB: 

Position
19p13.11
AA seq 412 aa AA seqDB search
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ
PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG
QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLA
ANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLE
HQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTE
TALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtgtgctgaaccctctgagccctctgccccactgcccgccggggtcccaccg
ctcgaggacttcgaggtactggatggggttgaggatgcagagggtgaggaggaagaggag
gaggaagaggaggaagaggatgacctgagtgagctgccaccgctggaggacatgggacaa
cccccggcggaggaggctgagcagcctggggccctggcccgagagttccttgctgccatg
gagcccgagcccgccccagccccggccccagaagagtggctggacattctggggaacggg
ctgttgaggaagaagacgctggtcccagggccgccaggttcgagccgcccggtcaagggc
caggtggtcaccgtacatctgcagacgtcgctggagaatggcacacgggtgcaggaggag
ccggagctggtgttcactctgggtgactgtgacgtcatccaggccctggatctcagtgtc
ccactcatggacgtgggggagacggccatggtcactgctgactccaagtactgctacggc
ccccaaggcaggagcccatacatccccccgcacgcggccctgtgcctggaggtgaccctg
aagacggctgtggacgggcctgacctggagatgctcacggggcaggagcgcgtggccctg
gccaaccggaagcgggagtgcggcaacgcccactaccagcgggcggacttcgtcctggcc
gccaactcctacgacctcgccatcaaggctatcacctccagcgccaaagtggacatgacg
ttcgaggaggaggcacagctcctgcagttgaaggtgaagtgtctgaacaacctggcggcc
tcgcagctgaagctcgaccactaccgcgcagccctgcgctcctgcagccttgtgctggag
caccagccagacaacatcaaggctctcttccgcaagggcaaggtgctggcccagcagggg
gagtacagtgaggccatccccatcctgagggcagccctgaagctggaaccttccaacaag
acgatccacgcagagctctcaaagctggtgaagaagcatgcggcgcagcggagcacggag
accgccttgtaccggaaaatgctgggcaaccccagccggctgcctgctaagtgccctggc
aagggtgcctggtccatcccatggaagtggctgtttggggcgactgctgttgccttgggg
ggtgtggcactctctgtggtcatcgctgccaggaactga

DBGET integrated database retrieval system