KEGG   Homo sapiens (human): 23774Help
Entry
23774             CDS       T01001                                 

Gene name
BRD1, BRL, BRPF1, BRPF2
Definition
(RefSeq) bromodomain containing 1
  KO
K11349  bromodomain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23774 (BRD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     23774 (BRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 EPL1 zf-HC5HC2H Bromodomain PWWP PHD_2 PHD AAA_23
Motif
Other DBs
NCBI-GeneID: 23774
NCBI-ProteinID: NP_001291738
OMIM: 604589
HGNC: 1102
Ensembl: ENSG00000100425
Vega: OTTHUMG00000150288
Pharos: O95696(Tbio)
UniProt: O95696 A0A024R4W4 Q59G93
Structure
PDB: 
5FG6 5PQI 5PSJ 5PSK 5PSL 5PST 5PTM 5POU 5PSQ 5PT0 5PO5 5PPX 5PPW 5PPY 5PQC 5PRP 5PTS 5PO0 5PPE 5PTG 5PNX 5PQ2 5PT9 5PTN 5PTT 5PNY 5POC 5PPB 5PSN 5PTK 5PV3 5PVT 5PO4 5PTF 5PTQ 5PUZ 5PV8 5PO7 5PO8 5POO 5POZ 5PTZ 5PUI 5PUX 5PO1 5POE 5PON 5PP6 5PP7 5PQH 5PQL 5PS6 5PT2 5PTR 5PPS 5PQE 5PSM 5PSV 5PSW 5PSZ 5PT6 5PTL 5PVB 5PVD 5PVL 5POM 5PT1 5PT4 5PPG 5PPZ 5PQ1 5PRO 5PS2 5PSG 5PSO 5PT7 5PU4 5PU5 5PU8 5PVS 5PNZ 5POD 5POK 5PPI 5PQ7 5PSU 5PTH 5PU9 5PVC 5POV 5PVJ 5PVR 5PW1 5POP 5POR 5PQB 5PQK 5PRU 5PSP 5PV4 5PV7 5PVK 5AME 5PQJ 5PSR 5PSS 5PSX 5PU2 5PQ5 5PQ9 5PTX 5PUP 5PO6 5POH 5PP0 5PP2 5PPC 5PPJ 5PPT 5PVQ 5POA 5POJ 5POL 5PRV 5PRZ 5PSB 5PSI 5PU7 5PV6 5POT 5PPL 5PPU 5PQ4 5PRR 5PSD 5PTE 5PUA 5PV2 5PVN 5PPF 5PQ6 5PSA 5PUC 5PUK 5PVZ 5PQ8 5PQD 5PQF 5PRW 5PVM 5PT8 5PO2 5PPD 5PTO 5PUS 5PV9 5PPP 5PRQ 5PS0 5PSC 5PV5 5PTJ 5PTU 5PUU 5PUV 5PVG 5PVH 5PVP 5PO3 5PPQ 5PPV 5PS4 5PT3 5PTV 5PUE 5PUQ 5PS1 5PS9 5PVF 5PQ3 5PRS 5PRE 5PU1 5PUR 5PV1 5PP8 5PU6 5PVX 6IN2 5POS 5POX 5PQO 5PRL 5AMF 5POY 5PT5 5PV0 5POG 5POW 5POB 5PQA 5PTC 5PPN 5PR6 5PR7 5PRY 5PVV 5PQ0 5PP9 5PQG 5PQS 5PR4 5PR9 5PRF 5PSY 5PTW 5PUF 5PUW 5PPO 5PUN 5PW7 5PWA 5PP5 5PPK 5PPM 5PRA 5PRX 4Z02 5PTB 5PPH 5PQT 5PQY 5PRT 5PU0 5PRD 5PRI 5PUJ 5PPA 5PW4 5PP4 5PR8 5PUH 5PS3 5PS8 5N49 5PQX 5PR5 5PRH 5PUL 5PVO 5POQ 5PQP 5PQV 5PVA 5PQN 5PQU 5PQW 5PUG 5PUD 5PUY 5PUO 5PW8 5PW5 5PWB 5PR1 5PR2 5PTY 3LYI 5PO9 5PW0 5PS5 5PUM 5PRJ 5PVW 5PSE 5PTA 5PVI 5PS7 5PW3 3RCW 5PR0 5PRB 5PRK 5PUB 5POF 5PVE 5PQQ 5PSF 5PUT 5PW2 5PP1 5POI 5PU3 5GK9 5PQR 5PVY 5PQM 5PP3 5PQZ 5PRG 5PPR 5PW6 5PVU 5PSH 5PW9 5PRM 2LQ6 2KU3
Thumbnails

Position
22q13.33
AA seq 1058 aa AA seqDB search
MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLEGFEEDGAALG
PEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGN
YAKAARIAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHN
GVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKM
MEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggaaaggacgatgtcatcgaggctctgcagcgaggcatccttcttccccatgc
agtgttaaacactcccctacgcgagaaacgctgacctacgctcaagctcaaaggatggta
gagatagaaattgaagggcgcttgcacaggatcagtatttttgatcccctggagatcata
ttggaagatgacctcactgctcaagagatgagtgagtgcaacagcaacaaggaaaacagc
gagcggcctcctgtctgcttaagaactaagcgtcacaaaaacaacagagtcaaaaagaaa
aacgaggccctccccagcgcccacggcacgccggcctcggccagtgccctcccggagccc
aaggtgcgcatcgtggagtacagccctccgtccgcccccaggaggcctcctgtgtactac
aagttcatcgagaagtcggccgaggaactggacaacgaggtggagtatgacatggacgag
gaggactatgcctggctggagatcgtcaatgagaagcgcaagggcgactgcgtccccgcc
gtgtcgcagagcatgtttgagttcctgatggaccgcttcgagaaggagtcgcactgcgag
aaccagaagcagggcgagcagcagtctctgatcgacgaggacgccgtgtgctgcatctgc
atggacggggagtgtcagaacagcaacgtgatcctcttctgcgacatgtgcaacctggcc
gtgcaccaggagtgctacggggtgccctacatccccgagggccagtggctctgccgccac
tgcctgcagtcgcgggcccggcccgccgactgtgtgctgtgccccaacaagggtggtgcc
ttcaaaaagacagatgacgaccgctggggtcacgtggtgtgtgccctgtggatcccagag
gtcggctttgccaacacggtgttcatcgagcccatcgatggggtgaggaacatccctcca
gcccggtggaaactgacatgctacctctgtaagcagaagggcgtgggtgcctgcatccag
tgccacaaagcaaactgctacacagcattccatgtgacgtgtgcccagaaggctggcctg
tacatgaaaatggagcccgtgaaggaactgactggcggtggcaccaccttctccgtcaga
aagaccgcttactgtgatgtccacacgcctccaggctgcacccggaggcctctgaatatt
tacggggatgtcgaaatgaaaaatggcgtctgtcgaaaagagagctcggttaaaacggtc
aggtccacatccaaggtcaggaagaaggcaaaaaaggctaagaaagctctggctgagccc
tgcgcggtcctgccgaccgtgtgcgctccttatattcccccgcagaggttaaataggatt
gcgaatcaggtggccattcagcggaagaagcagtttgtggagcgagcccacagctactgg
ctgctcaagcggctgtccaggaacggggcccccctgctgcggcggctgcagtccagcctg
cagtctcagcgaagctcacagcagagagaaaatgatgaggagatgaaggctgccaaagag
aagctgaagtactggcagcggctgcggcacgacctggagcgcgctcgcctgctgatcgag
ctgctgcgcaagcgggagaagctcaagcgtgagcaggtgaaggtggagcaggtcgccatg
gagctgcggctgaccccgctgacggtgctgctgcgctcagtgctggaccagctgcaagac
aaggaccccgccaggatatttgcgcagcccgtgagtctgaaggaggtaccagattatttg
gatcacattaaacatcccatggactttgccacaatgaggaaacggttagaagctcaaggg
tataaaaacctccatgagtttgaggaggattttgatctcattatagataactgcatgaag
tacaatgccagggacaccgtgttctatagagccgcggtgaggctgcgcgatcagggaggt
gttgttctgaggcaggcccggcgcgaggtggacagcatcggcttggaagaggcctcgggg
atgcacctgcctgagcggcctgctgcggcaccgcggcggcctttctcctgggaagacgtg
gacaggttgctggaccccgccaacagagcccacctgggcctggaggagcagctgagagag
ctgctggacatgctcgacctcacctgcgctatgaagtccagcggctcccggagcaagcgg
gcaaagctgctcaaaaaggaaattgcccttctccgaaacaagctgagccagcagcacagc
cagcccctgcccacggggccaggcttggaaggcttcgaagaggacggagctgcgctgggg
ccggaggcgggcgaggaagtccttccgaggttggagactcttctgcagccaaggaaaagg
tcgcggagcacatgcggagactccgaggtggaggaggagtccccaggaaagcgcctggac
gcaggtctcaccaacggctttgggggtgcgaggagcgagcaggagccgggcggcggcctg
gggaggaaggccacaccccgacgacgctgtgcctccgagtccagcatctcctccagcaac
agcccgctctgcgactcgagctttaatgcgcccaaatgtgggcggggcaaaccggctctt
gtgcgacggcacacgctggaggaccgcagtgagctgatctcctgcatcgagaatgggaac
tacgccaaggcggccaggatcgcagccgaagtcggccagagcagcatgtggatctccact
gatgccgccgcctcggtgctggagcctctgaaggtggtgtgggccaagtgcagcggctac
ccctcctacccggcactgatcatcgaccccaagatgccccgtgtgcctggccaccacaac
ggcgtcaccatcccggccccacccctggacgtgctgaagattggggagcacatgcagacc
aagtctgatgagaagctgttcctcgttctcttttttgataataagagaagttggcagtgg
cttcctaagtccaaaatggttccccttggtattgacgaaactatagacaagttaaagatg
atggaagggaggaattccagcatccggaaggccgtgcggatcgcttttgaccgcgccatg
aaccacctgagccgcgtccacggggagccgaccagcgacctcagtgacattgactga

DBGET integrated database retrieval system