KEGG   Homo sapiens (human): 23779Help
Entry
23779             CDS       T01001                                 

Gene name
ARHGAP8, BPGAP1, PP610
Definition
(RefSeq) Rho GTPase activating protein 8
  KO
K20633  Rho GTPase-activating protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23779 (ARHGAP8)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    23779 (ARHGAP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP CRAL_TRIO_2 CRAL_TRIO
Motif
Other DBs
NCBI-GeneID: 23779
NCBI-ProteinID: NP_001017526
OMIM: 609405
HGNC: 677
Ensembl: ENSG00000241484
Vega: OTTHUMG00000030234
Pharos: P85298(Tbio)
UniProt: P85298 Q6PJW1
Position
22q13.31
AA seq 464 aa AA seqDB search
MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKY
TLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSS
HLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHL
KYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELI
PPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILK
TFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLRYLMGFLHAVS
RESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctggccaggatcctgcgctgagcacgagtcacccgttctacgacgtggccagacat
ggcattctgcaggtggcaggggatgaccgctttggaagacgtgttgtcacgttcagctgc
tgccggatgccaccctcccacgagctggaccaccagcggctgctggagtatttgaagtac
acactggaccaatacgttgagaacgattataccatcgtctatttccactacgggctgaac
agccggaacaagccttccctgggctggctccagagcgcatacaaggagttcgataggaaa
gacggggatctcactatgtggcccaggctggtctcgaactccaagctcaagcgatcctcc
cacctcagcctcccaaagtactgggattacaggtacaagaagaacttgaaggccctctac
gtggtgcaccccaccagcttcatcaaggtcctgtggaacatcttgaagcccctcatcagt
cacaagtttgggaagaaagtcatctatttcaactacctgagtgagctccacgaacacctt
aaatacgaccagctggtcatccctcccgaagttttgcggtacgatgagaagctccagagc
ctgcacgagggccggacgccgcctcccaccaagacaccaccgccgcggcccccgctgccc
acacagcagtttggcgtcagtctgcaatacctcaaagacaaaaatcaaggcgaactcatc
ccccctgtgctgaggttcacagtgacgtacctgagagagaaaggcctgcgcaccgagggc
ctgttccggagatccgccagcgtgcagaccgtccgcgagatccagaggctctacaaccaa
gggaagcccgtgaactttgacgactacggggacattcacatccctgccgtgatcctgaag
accttcctgcgagagctgccccagccgcttctgaccttccaggcctacgagcagattctc
gggatcacctgtgtggagagcagcctgcgtgtcactggctgccgccagatcttacggagc
ctcccagagcacaactacgtcgtcctccgctacctcatgggcttcctgcatgcggtgtcc
cgggagagcatcttcaacaaaatgaacagctctaacctggcctgtgtcttcgggctgaat
ttgatctggccatcccagggggtctcctccctgagtgcccttgtgcccctgaacatgttc
actgaactgctgatcgagtactatgaaaagatcttcagcaccccggaggcacctggggag
cacggcctggcaccatgggaacaggggagcagggcagcccctttgcaggaggctgtgcca
cggacacaagccacgggcctcaccaagcctaccctacctccgagtcccctgatggcagcc
agaagacgtctctag

DBGET integrated database retrieval system