KEGG   Homo sapiens (human): 23787
Entry
23787             CDS       T01001                                 

Gene name
MTCH1, CGI-64, PIG60, PSAP, SLC25A49
Definition
(RefSeq) mitochondrial carrier 1
  KO
K17885  mitochondrial carrier
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23787 (MTCH1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23787 (MTCH1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    23787 (MTCH1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   23787 (MTCH1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 23787
NCBI-ProteinID: NP_001258570
OMIM: 610449
HGNC: 17586
Ensembl: ENSG00000137409
Vega: OTTHUMG00000014614
Pharos: Q9NZJ7(Tbio)
UniProt: Q9NZJ7 A8YXX5 A0A024RCX4
Position
6p21.2
AA seq 389 aa
MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQP
SARRMDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN
VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ
VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI
GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG
SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW
KYLSVQGQLFRGSSLLFRRVSSGSCFALE
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgggagcttcggacccggaagtggcgccctgggctcgcggcggtgccgcggggatggcg
ggagccggagctggagccggagctcgcggcggagcggcggcgggggtcgaggctcgagct
cgcgatccaccgcccgcgcaccgcgcacatcctcgccaccctcggcctgcggctcagccc
tcggcccgcaggatggatggcgggtcagggggcctggggtctggggacaacgccccgacc
actgaggctcttttcgtggcactgggcgcgggcgtgacggcgctcagccatcccctgctc
tacgtgaagctgctcatccaggtgggtcatgagccgatgccccccacccttgggaccaat
gtgctggggaggaaggtcctctatctgccgagcttcttcacctacgccaagtacatcgtg
caagtggatggtaagatagggctgttccgaggcctgagtccccggctgatgtccaacgcc
ctctctactgtgactcggggtagcatgaagaaggttttccctccagatgagattgagcag
gtttccaacaaggatgatatgaagacttccctgaagaaagttgtgaaggagacctcctac
gagatgatgatgcagtgtgtgtcccgcatgttggcccaccccctgcatgtcatctcaatg
cgctgcatggtccagtttgtgggacgggaggccaagtacagtggtgtgctgagctccatt
gggaagattttcaaagaggaagggctgctgggattcttcgttggattaatccctcacctc
ctgggcgatgtggttttcttgtggggctgtaacctgctggcccacttcatcaatgcctac
ctggtggatgacagcgtgagtgacaccccaggggggctgggaaacgaccagaatccaggt
tcccagttcagccaggccctggccatccggagctataccaagttcgtgatggggattgca
gtgagcatgctgacctaccccttcctgctagttggcgacctcatggctgtgaacaactgc
gggctgcaagctgggctccccccttactccccagtgttcaaatcctggattcactgctgg
aagtacctgagtgtgcagggccagctcttccgaggctccagcctgcttttccgccgggtg
tcatcaggatcatgctttgccctggagtaa

DBGET integrated database retrieval system