KEGG   Homo sapiens (human): 23788
Entry
23788             CDS       T01001                                 

Gene name
MTCH2, HSPC032, MIMP, SLC25A50
Definition
(RefSeq) mitochondrial carrier 2
  KO
K17885  mitochondrial carrier
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23788 (MTCH2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23788 (MTCH2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    23788 (MTCH2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   23788 (MTCH2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 23788
NCBI-ProteinID: NP_055157
OMIM: 613221
HGNC: 17587
Ensembl: ENSG00000109919
Vega: OTTHUMG00000166926
Pharos: Q9Y6C9(Tbio)
UniProt: Q9Y6C9
Position
11p11.2
AA seq 303 aa
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQH
IASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHV
IKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFA
GLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLV
SNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLK
MLI
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcggacgcggccagtcaggtgctcctgggctccggtctcaccatcctgtcccagccg
ctcatgtacgtgaaagtgctcatccaggtgggatatgagcctcttcctccaacaatagga
cgaaatatttttgggcggcaagtgtgtcagcttcctggtctctttagttatgctcagcac
attgccagtatcgatgggaggcgcgggttgttcacaggcttaactccaagactgtgttcg
ggagtccttggaactgtggtccatggtaaagttttacagcattaccaggagagtgacaag
ggtgaggagttaggacctggaaatgtacagaaagaagtctcatcttcctttgaccacgtt
atcaaggagacaactcgagagatgatcgctcgttctgctgctaccctcatcacacatccc
ttccatgtgatcactctgagatctatggtacagttcattggcagagaatccaagtactgt
ggactttgtgattccataataaccatctatcgggaagagggcattctaggatttttcgcg
ggtcttgttcctcgccttctaggtgacatcctttctttgtggctgtgtaactcactggcc
tacctcgtcaatacctatgcactggacagtggggtttctaccatgaatgaaatgaagagt
tattctcaagctgtcacaggattttttgcgagtatgttgacctatccctttgtgcttgtc
tccaatcttatggctgtcaacaactgtggtcttgctggtggatgccctccttactcccca
atatatacgtcttggatagactgttggtgcatgctacaaaaagaggggaatatgagccga
ggaaatagcttatttttccggaaggtcccctttgggaagacttattgttgtgacctgaaa
atgttaatttga

DBGET integrated database retrieval system